Viewing data for Aotus azarai


Scientific name Aotus azarai
Common name Azara's night monkey
Maximum lifespan 30.00 years (Aotus azarai@AnAge)

Total mtDNA (size: 16585 bases) GC AT G C A T
Base content (bases) 6394 10191 4279 2115 4774 5417
Base content per 1 kb (bases) 386 614 258 128 288 327
Base content (%) 38.6% 61.4%
Total protein-coding genes (size: 11352 bases) GC AT G C A T
Base content (bases) 4352 7000 3060 1292 3390 3610
Base content per 1 kb (bases) 383 617 270 114 299 318
Base content (%) 38.3% 61.7%
D-loop (size: 1160 bases) GC AT G C A T
Base content (bases) 476 684 310 166 319 365
Base content per 1 kb (bases) 410 590 267 143 275 315
Base content (%) 41.0% 59.0%
Total tRNA-coding genes (size: 1504 bases) GC AT G C A T
Base content (bases) 531 973 311 220 435 538
Base content per 1 kb (bases) 353 647 207 146 289 358
Base content (%) 35.3% 64.7%
Total rRNA-coding genes (size: 2512 bases) GC AT G C A T
Base content (bases) 1008 1504 581 427 614 890
Base content per 1 kb (bases) 401 599 231 170 244 354
Base content (%) 40.1% 59.9%
12S rRNA gene (size: 957 bases) GC AT G C A T
Base content (bases) 393 564 218 175 231 333
Base content per 1 kb (bases) 411 589 228 183 241 348
Base content (%) 41.1% 58.9%
16S rRNA gene (size: 1555 bases) GC AT G C A T
Base content (bases) 615 940 363 252 383 557
Base content per 1 kb (bases) 395 605 233 162 246 358
Base content (%) 39.5% 60.5%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 248 433 178 70 214 219
Base content per 1 kb (bases) 364 636 261 103 314 322
Base content (%) 36.4% 63.6%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 53 148 42 11 65 83
Base content per 1 kb (bases) 264 736 209 55 323 413
Base content (%) 26.4% 73.6%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 618 939 372 246 500 439
Base content per 1 kb (bases) 397 603 239 158 321 282
Base content (%) 39.7% 60.3%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 267 421 178 89 203 218
Base content per 1 kb (bases) 388 612 259 129 295 317
Base content (%) 38.8% 61.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 341 443 227 114 220 223
Base content per 1 kb (bases) 435 565 290 145 281 284
Base content (%) 43.5% 56.5%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 461 679 320 141 355 324
Base content per 1 kb (bases) 404 596 281 124 311 284
Base content (%) 40.4% 59.6%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 379 577 273 106 276 301
Base content per 1 kb (bases) 396 604 286 111 289 315
Base content (%) 39.6% 60.4%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 362 677 280 82 303 374
Base content per 1 kb (bases) 348 652 269 79 292 360
Base content (%) 34.8% 65.2%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 122 224 86 36 109 115
Base content per 1 kb (bases) 353 647 249 104 315 332
Base content (%) 35.3% 64.7%
ND4 (size: 1375 bases) GC AT G C A T
Base content (bases) 510 865 379 131 410 455
Base content per 1 kb (bases) 371 629 276 95 298 331
Base content (%) 37.1% 62.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 103 194 68 35 106 88
Base content per 1 kb (bases) 347 653 229 118 357 296
Base content (%) 34.7% 65.3%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 696 1110 510 186 534 576
Base content per 1 kb (bases) 385 615 282 103 296 319
Base content (%) 38.5% 61.5%
ND6 (size: 534 bases) GC AT G C A T
Base content (bases) 203 331 156 47 114 217
Base content per 1 kb (bases) 380 620 292 88 213 406
Base content (%) 38.0% 62.0%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 21 (9.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 46 (20.35%)
Isoleucine (Ile, I)
n = 27 (11.95%)
Methionine (Met, M)
n = 15 (6.64%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 10 (4.42%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 2 (0.88%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 5 (2.21%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 10 11 10 3 17 3 12 8 1 0 3 7 0 6 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 2 7 1 1 2 5 1 1 7 4 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 6 4 3 0 1 1 3 1 0 1 5 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 1 1 1 1 3 2 0 0 4 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 63 82 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
18 61 40 108
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 54 97 62
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDISPWPMVILSMIAALFYFIQLKLLNFTFYNTPLSKPMKTQKHKTTWELKWTKIYLPLSMSQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.03%)
Serine (Ser, S)
n = 5 (7.58%)
Threonine (Thr, T)
n = 6 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.52%)
Leucine (Leu, L)
n = 10 (15.15%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 5 (7.58%)
Proline (Pro, P)
n = 6 (9.09%)
Phenylalanine (Phe, F)
n = 4 (6.06%)
Tyrosine (Tyr, Y)
n = 3 (4.55%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 1 (1.52%)
Asparagine (Asn, N)
n = 2 (3.03%)
Glutamine (Gln, Q)
n = 4 (6.06%)
Histidine (His, H)
n = 1 (1.52%)
Lysine (Lys, K)
n = 7 (10.61%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 4 1 0 3 1 5 4 0 0 0 0 1 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 1 0 0 0 0 0 2 0 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 0 1 1 3 0 0 0 2 1 0 0 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 1 0 7 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 16 25 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 19 20 25
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 7 38 19
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.88%)
Alanine (Ala, A)
n = 37 (7.14%)
Serine (Ser, S)
n = 35 (6.76%)
Threonine (Thr, T)
n = 39 (7.53%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.56%)
Leucine (Leu, L)
n = 61 (11.78%)
Isoleucine (Ile, I)
n = 42 (8.11%)
Methionine (Met, M)
n = 30 (5.79%)
Proline (Pro, P)
n = 28 (5.41%)
Phenylalanine (Phe, F)
n = 41 (7.92%)
Tyrosine (Tyr, Y)
n = 21 (4.05%)
Tryptophan (Trp, W)
n = 16 (3.09%)
Aspartic acid (Asp, D)
n = 14 (2.7%)
Glutamic acid (Glu, E)
n = 11 (2.12%)
Asparagine (Asn, N)
n = 18 (3.47%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 18 (3.47%)
Lysine (Lys, K)
n = 11 (2.12%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 10 23 12 6 26 3 14 7 0 8 8 14 4 19 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 9 14 14 0 11 11 20 4 12 6 8 2 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 15 2 9 7 15 0 1 3 13 8 1 0 8 10 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 3 9 5 10 1 1 2 5 0 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
142 108 145 124
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 100 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 129 194 168
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 16 (7.02%)
Serine (Ser, S)
n = 18 (7.89%)
Threonine (Thr, T)
n = 15 (6.58%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 8 (3.51%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 24 (10.53%)
Methionine (Met, M)
n = 13 (5.7%)
Proline (Pro, P)
n = 12 (5.26%)
Phenylalanine (Phe, F)
n = 11 (4.82%)
Tyrosine (Tyr, Y)
n = 13 (5.7%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 10 (4.39%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 6 (2.63%)
Glutamine (Gln, Q)
n = 8 (3.51%)
Histidine (His, H)
n = 6 (2.63%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 11 11 8 3 11 1 6 7 1 3 2 3 0 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 6 5 5 0 2 3 3 0 2 3 6 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 7 0 2 3 9 0 0 4 8 5 0 1 3 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 13 1 4 6 4 0 3 1 1 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 55 66 52
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 57 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 66 91 64
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 17 (6.54%)
Threonine (Thr, T)
n = 26 (10.0%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 26 (10.0%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 14 (5.38%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 15 (5.77%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 7 10 4 5 11 2 4 9 0 3 3 8 0 7 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 3 11 7 0 3 7 9 1 3 6 5 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 0 5 3 4 1 2 2 6 9 0 0 3 2 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 1 2 1 2 0 1 1 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 66 61 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 74 58 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 87 104 64
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.07%)
Alanine (Ala, A)
n = 24 (6.33%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 31 (8.18%)
Cysteine (Cys, C)
n = 2 (0.53%)
Valine (Val, V)
n = 14 (3.69%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 18 (4.75%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 13 (3.43%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 11 (2.9%)
Arginine (Arg, R)
n = 7 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 15 16 14 7 23 3 9 8 0 3 3 8 0 14 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 5 11 8 0 5 8 9 1 2 12 9 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 1 6 9 7 1 1 2 8 6 1 0 5 8 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 2 5 7 7 4 0 2 5 0 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 96 115 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 101 75 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 123 134 107
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 24 (7.57%)
Threonine (Thr, T)
n = 28 (8.83%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 12 (3.79%)
Leucine (Leu, L)
n = 58 (18.3%)
Isoleucine (Ile, I)
n = 25 (7.89%)
Methionine (Met, M)
n = 20 (6.31%)
Proline (Pro, P)
n = 19 (5.99%)
Phenylalanine (Phe, F)
n = 18 (5.68%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 5 (1.58%)
Lysine (Lys, K)
n = 8 (2.52%)
Arginine (Arg, R)
n = 7 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 11 17 6 9 33 1 9 6 0 3 2 6 1 12 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 5 11 12 0 2 8 2 0 4 9 6 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 2 5 5 11 1 0 2 5 7 0 0 5 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 0 2 1 7 1 0 1 6 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 86 95 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 97 57 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 90 148 71
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 15 (4.35%)
Serine (Ser, S)
n = 31 (8.99%)
Threonine (Thr, T)
n = 33 (9.57%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 61 (17.68%)
Isoleucine (Ile, I)
n = 36 (10.43%)
Methionine (Met, M)
n = 39 (11.3%)
Proline (Pro, P)
n = 23 (6.67%)
Phenylalanine (Phe, F)
n = 14 (4.06%)
Tyrosine (Tyr, Y)
n = 10 (2.9%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.93%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 12 (3.48%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 11 35 10 7 33 2 9 9 0 1 0 7 0 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 6 5 0 0 5 6 1 2 10 11 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 20 0 3 12 12 0 0 4 4 6 0 0 9 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 1 1 1 10 2 0 2 1 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 92 141 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 98 60 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 90 173 73
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 15 (4.35%)
Serine (Ser, S)
n = 31 (8.99%)
Threonine (Thr, T)
n = 33 (9.57%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 61 (17.68%)
Isoleucine (Ile, I)
n = 36 (10.43%)
Methionine (Met, M)
n = 39 (11.3%)
Proline (Pro, P)
n = 23 (6.67%)
Phenylalanine (Phe, F)
n = 14 (4.06%)
Tyrosine (Tyr, Y)
n = 10 (2.9%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.93%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 12 (3.48%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 11 35 10 7 33 2 9 9 0 1 0 7 0 8 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 6 5 0 0 5 6 1 2 10 11 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 20 0 3 12 12 0 0 4 4 6 0 0 9 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 1 1 1 10 2 0 2 1 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 92 141 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 98 60 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 90 173 73
ND4 (size: 1375 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.16%)
Alanine (Ala, A)
n = 26 (5.69%)
Serine (Ser, S)
n = 36 (7.88%)
Threonine (Thr, T)
n = 43 (9.41%)
Cysteine (Cys, C)
n = 4 (0.88%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 93 (20.35%)
Isoleucine (Ile, I)
n = 37 (8.1%)
Methionine (Met, M)
n = 43 (9.41%)
Proline (Pro, P)
n = 26 (5.69%)
Phenylalanine (Phe, F)
n = 20 (4.38%)
Tyrosine (Tyr, Y)
n = 16 (3.5%)
Tryptophan (Trp, W)
n = 12 (2.63%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 22 (4.81%)
Glutamine (Gln, Q)
n = 8 (1.75%)
Histidine (His, H)
n = 10 (2.19%)
Lysine (Lys, K)
n = 12 (2.63%)
Arginine (Arg, R)
n = 10 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 10 39 12 19 37 2 22 8 0 3 3 2 1 8 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 1 4 16 6 0 4 8 6 1 3 12 11 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 22 2 6 7 14 0 2 7 8 8 0 1 10 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 9 0 2 1 12 0 1 0 9 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 124 166 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 122 80 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 133 209 105
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 6 (6.12%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 27 (27.55%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 6 (6.12%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 8 3 1 15 3 5 2 0 2 0 3 2 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 1 3 3 0 1 2 1 0 2 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 0 3 1 2 0 0 0 2 4 0 0 3 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 0 0 1 0 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 29 24 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 19 19 53
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 20 45 28
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.16%)
Alanine (Ala, A)
n = 39 (6.49%)
Serine (Ser, S)
n = 60 (9.98%)
Threonine (Thr, T)
n = 62 (10.32%)
Cysteine (Cys, C)
n = 3 (0.5%)
Valine (Val, V)
n = 16 (2.66%)
Leucine (Leu, L)
n = 88 (14.64%)
Isoleucine (Ile, I)
n = 61 (10.15%)
Methionine (Met, M)
n = 34 (5.66%)
Proline (Pro, P)
n = 27 (4.49%)
Phenylalanine (Phe, F)
n = 46 (7.65%)
Tyrosine (Tyr, Y)
n = 15 (2.5%)
Tryptophan (Trp, W)
n = 12 (2.0%)
Aspartic acid (Asp, D)
n = 10 (1.66%)
Glutamic acid (Glu, E)
n = 11 (1.83%)
Asparagine (Asn, N)
n = 29 (4.83%)
Glutamine (Gln, Q)
n = 20 (3.33%)
Histidine (His, H)
n = 16 (2.66%)
Lysine (Lys, K)
n = 19 (3.16%)
Arginine (Arg, R)
n = 8 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
35 26 31 15 15 42 4 12 20 0 5 2 8 1 17 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 0 9 14 16 0 2 12 9 2 2 14 11 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 26 1 12 10 19 2 6 11 10 5 1 0 16 13 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 3 3 7 16 3 3 2 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
101 147 222 132
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 171 121 245
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 192 233 157
ND6 (size: 534 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.12%)
Alanine (Ala, A)
n = 10 (5.65%)
Serine (Ser, S)
n = 9 (5.08%)
Threonine (Thr, T)
n = 12 (6.78%)
Cysteine (Cys, C)
n = 2 (1.13%)
Valine (Val, V)
n = 17 (9.6%)
Leucine (Leu, L)
n = 20 (11.3%)
Isoleucine (Ile, I)
n = 14 (7.91%)
Methionine (Met, M)
n = 17 (9.6%)
Proline (Pro, P)
n = 5 (2.82%)
Phenylalanine (Phe, F)
n = 10 (5.65%)
Tyrosine (Tyr, Y)
n = 10 (5.65%)
Tryptophan (Trp, W)
n = 4 (2.26%)
Aspartic acid (Asp, D)
n = 4 (2.26%)
Glutamic acid (Glu, E)
n = 8 (4.52%)
Asparagine (Asn, N)
n = 3 (1.69%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.13%)
Lysine (Lys, K)
n = 3 (1.69%)
Arginine (Arg, R)
n = 2 (1.13%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 1 9 1 0 1 0 7 0 0 9 0 2 6 8 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 0 6 0 1 3 15 0 2 8 4 0 0 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 4 2 0 1 2 4 0 10 0 2 11 3 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 6 3 1 0 3 1 0 0 1 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 11 53 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 32 31 78
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
55 4 30 89
Total protein-coding genes (size: 11404 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 206 (5.42%)
Alanine (Ala, A)
n = 251 (6.61%)
Serine (Ser, S)
n = 284 (7.48%)
Threonine (Thr, T)
n = 330 (8.69%)
Cysteine (Cys, C)
n = 20 (0.53%)
Valine (Val, V)
n = 152 (4.0%)
Leucine (Leu, L)
n = 603 (15.88%)
Isoleucine (Ile, I)
n = 340 (8.95%)
Methionine (Met, M)
n = 259 (6.82%)
Proline (Pro, P)
n = 203 (5.34%)
Phenylalanine (Phe, F)
n = 238 (6.27%)
Tyrosine (Tyr, Y)
n = 142 (3.74%)
Tryptophan (Trp, W)
n = 103 (2.71%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 93 (2.45%)
Asparagine (Asn, N)
n = 151 (3.98%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 98 (2.58%)
Lysine (Lys, K)
n = 97 (2.55%)
Arginine (Arg, R)
n = 62 (1.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
222 118 219 97 76 271 26 119 91 2 41 27 68 16 115 123
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
40 12 8 62 97 88 4 46 67 73 20 42 81 76 4 78
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
90 150 12 62 62 100 7 17 36 81 61 5 14 75 76 46
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
52 75 18 34 33 80 17 11 12 37 2 0 1 5 1 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
769 926 1231 873
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
445 1015 747 1592
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
189 1019 1550 1041

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.