Viewing data for Chrysocyon brachyurus


Scientific name Chrysocyon brachyurus
Common name Maned wolf
Maximum lifespan 16.80 years (Chrysocyon brachyurus@AnAge)

Total mtDNA (size: 16760 bases) GC AT G C A T
Base content (bases) 6432 10328 4119 2313 4939 5389
Base content per 1 kb (bases) 384 616 246 138 295 322
Base content (%) 38.4% 61.6%
Total protein-coding genes (size: 11336 bases) GC AT G C A T
Base content (bases) 4341 6995 2930 1411 3453 3542
Base content per 1 kb (bases) 383 617 258 124 305 312
Base content (%) 38.3% 61.7%
D-loop (size: 1298 bases) GC AT G C A T
Base content (bases) 563 735 337 226 377 358
Base content per 1 kb (bases) 434 566 260 174 290 276
Base content (%) 43.4% 56.6%
Total tRNA-coding genes (size: 1517 bases) GC AT G C A T
Base content (bases) 529 988 298 231 457 531
Base content per 1 kb (bases) 349 651 196 152 301 350
Base content (%) 34.9% 65.1%
Total rRNA-coding genes (size: 2536 bases) GC AT G C A T
Base content (bases) 964 1572 532 432 638 934
Base content per 1 kb (bases) 380 620 210 170 252 368
Base content (%) 38.0% 62.0%
12S rRNA gene (size: 957 bases) GC AT G C A T
Base content (bases) 370 587 207 163 235 352
Base content per 1 kb (bases) 387 613 216 170 246 368
Base content (%) 38.7% 61.3%
16S rRNA gene (size: 1579 bases) GC AT G C A T
Base content (bases) 594 985 325 269 403 582
Base content per 1 kb (bases) 376 624 206 170 255 369
Base content (%) 37.6% 62.4%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 261 420 184 77 220 200
Base content per 1 kb (bases) 383 617 270 113 323 294
Base content (%) 38.3% 61.7%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 73 131 57 16 58 73
Base content per 1 kb (bases) 358 642 279 78 284 358
Base content (%) 35.8% 64.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 600 945 337 263 508 437
Base content per 1 kb (bases) 388 612 218 170 329 283
Base content (%) 38.8% 61.2%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 254 430 158 96 202 228
Base content per 1 kb (bases) 371 629 231 140 295 333
Base content (%) 37.1% 62.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 320 464 202 118 253 211
Base content per 1 kb (bases) 408 592 258 151 323 269
Base content (%) 40.8% 59.2%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 458 682 307 151 344 338
Base content per 1 kb (bases) 402 598 269 132 302 296
Base content (%) 40.2% 59.8%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 381 575 270 111 287 288
Base content per 1 kb (bases) 399 601 282 116 300 301
Base content (%) 39.9% 60.1%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 375 667 284 91 294 373
Base content per 1 kb (bases) 360 640 273 87 282 358
Base content (%) 36.0% 64.0%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 133 213 89 44 104 109
Base content per 1 kb (bases) 384 616 257 127 301 315
Base content (%) 38.4% 61.6%
ND4 (size: 1376 bases) GC AT G C A T
Base content (bases) 510 866 360 150 436 430
Base content per 1 kb (bases) 371 629 262 109 317 313
Base content (%) 37.1% 62.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 103 194 62 41 107 87
Base content per 1 kb (bases) 347 653 209 138 360 293
Base content (%) 34.7% 65.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 701 1120 492 209 542 578
Base content per 1 kb (bases) 385 615 270 115 298 317
Base content (%) 38.5% 61.5%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 198 330 145 53 118 212
Base content per 1 kb (bases) 375 625 275 100 223 402
Base content (%) 37.5% 62.5%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 18 (7.96%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 21 (9.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 42 (18.58%)
Isoleucine (Ile, I)
n = 27 (11.95%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 10 (4.42%)
Histidine (His, H)
n = 5 (2.21%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 6 11 5 5 14 3 13 9 1 4 1 3 2 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 6 7 5 0 2 3 6 0 5 7 1 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 4 2 4 2 5 1 3 0 2 2 1 2 4 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 1 4 0 1 1 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 59 78 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 64 39 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 61 83 70
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITIFSMLLTLFILFQLKVSKHNYPENPMTKTTKTTSQHIPWENKWTKIYSPLSLPPQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 6 (8.96%)
Threonine (Thr, T)
n = 10 (14.93%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.49%)
Leucine (Leu, L)
n = 8 (11.94%)
Isoleucine (Ile, I)
n = 5 (7.46%)
Methionine (Met, M)
n = 3 (4.48%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 4 (5.97%)
Tyrosine (Tyr, Y)
n = 2 (2.99%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 3 (4.48%)
Glutamine (Gln, Q)
n = 4 (5.97%)
Histidine (His, H)
n = 2 (2.99%)
Lysine (Lys, K)
n = 6 (8.96%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 1 4 0 2 1 1 3 1 1 0 0 0 4 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 0 0 0 0 0 0 3 2 2 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 1 0 1 2 2 0 1 1 1 0 0 2 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 1 0 6 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 20 28 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 22 21 21
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 15 24 21
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 41 (7.98%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.81%)
Leucine (Leu, L)
n = 58 (11.28%)
Isoleucine (Ile, I)
n = 40 (7.78%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 16 22 15 1 17 3 21 4 3 7 2 21 5 26 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 0 1 13 9 18 1 12 6 23 6 12 8 8 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 19 1 11 5 10 1 1 2 8 11 3 1 12 5 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 3 8 7 8 1 1 0 7 0 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 97 141 129
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 96 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 105 200 171
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 7 15 6 4 6 3 14 6 1 6 3 5 1 6 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 2 3 3 1 1 1 5 1 4 0 8 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 8 0 9 1 4 0 0 4 6 5 0 1 3 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 13 2 1 9 4 0 0 0 5 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 52 65 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 61 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 52 102 60
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 22 (8.46%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 14 (5.38%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 4 8 6 5 13 0 7 6 1 3 4 8 2 12 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 5 7 1 1 1 7 10 2 4 3 4 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 10 1 5 8 4 1 1 3 7 7 0 1 5 2 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 7 1 2 1 2 0 0 1 3 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 63 59 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 64 57 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 75 95 78
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 22 (5.8%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 16 (4.22%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 9 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 23 14 6 11 24 2 13 4 2 4 1 10 2 12 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 6 8 7 1 5 4 11 4 4 6 11 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 12 0 7 4 9 1 0 3 8 6 1 2 7 10 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 0 2 9 9 0 0 3 6 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 92 115 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 93 75 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 122 148 92
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 21 (6.62%)
Threonine (Thr, T)
n = 22 (6.94%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 11 (3.47%)
Leucine (Leu, L)
n = 56 (17.67%)
Isoleucine (Ile, I)
n = 32 (10.09%)
Methionine (Met, M)
n = 18 (5.68%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 21 (6.62%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 12 17 7 13 24 3 9 5 1 1 2 8 0 8 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 4 13 11 1 1 4 5 2 6 6 8 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 9 0 4 5 10 0 0 2 7 4 0 0 5 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 2 1 6 1 0 1 7 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 87 94 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 92 55 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 91 138 77
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 16 (4.62%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 35 (10.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 41 (11.85%)
Methionine (Met, M)
n = 40 (11.56%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 16 (4.62%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 18 35 6 10 26 3 11 8 1 1 5 2 1 4 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 3 8 5 0 1 4 8 2 6 8 6 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 0 6 8 13 0 0 2 4 6 0 0 3 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 1 14 2 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 83 149 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 99 61 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 102 163 67
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 16 (4.62%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 35 (10.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 41 (11.85%)
Methionine (Met, M)
n = 40 (11.56%)
Proline (Pro, P)
n = 21 (6.07%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 16 (4.62%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 18 35 6 10 26 3 11 8 1 1 5 2 1 4 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 3 8 5 0 1 4 8 2 6 8 6 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 0 6 8 13 0 0 2 4 6 0 0 3 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 1 14 2 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 83 149 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 99 61 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 102 163 67
ND4 (size: 1376 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.94%)
Alanine (Ala, A)
n = 31 (6.78%)
Serine (Ser, S)
n = 41 (8.97%)
Threonine (Thr, T)
n = 36 (7.88%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 94 (20.57%)
Isoleucine (Ile, I)
n = 43 (9.41%)
Methionine (Met, M)
n = 31 (6.78%)
Proline (Pro, P)
n = 22 (4.81%)
Phenylalanine (Phe, F)
n = 19 (4.16%)
Tyrosine (Tyr, Y)
n = 17 (3.72%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 21 (4.6%)
Glutamine (Gln, Q)
n = 10 (2.19%)
Histidine (His, H)
n = 10 (2.19%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 25 27 23 9 33 4 21 9 1 4 1 8 2 9 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 1 6 9 16 0 6 6 5 1 5 8 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 17 1 14 6 12 0 4 5 10 7 1 4 8 13 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 7 1 1 2 10 3 1 1 8 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 121 153 109
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 121 82 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 118 194 124
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 13 (13.27%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 4 9 2 2 7 5 4 2 0 2 0 5 0 4 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 0 0 3 3 0 1 0 2 1 0 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 4 3 1 1 1 0 1 3 0 1 4 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 22 30 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 20 18 52
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 20 39 28
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.79%)
Alanine (Ala, A)
n = 36 (5.94%)
Serine (Ser, S)
n = 52 (8.58%)
Threonine (Thr, T)
n = 58 (9.57%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 18 (2.97%)
Leucine (Leu, L)
n = 89 (14.69%)
Isoleucine (Ile, I)
n = 60 (9.9%)
Methionine (Met, M)
n = 40 (6.6%)
Proline (Pro, P)
n = 24 (3.96%)
Phenylalanine (Phe, F)
n = 44 (7.26%)
Tyrosine (Tyr, Y)
n = 22 (3.63%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 29 (4.79%)
Glutamine (Gln, Q)
n = 20 (3.3%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 24 (3.96%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 31 35 16 19 36 2 13 16 4 4 4 9 1 20 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 4 8 12 15 1 5 10 10 4 12 5 6 1 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 22 3 8 12 13 4 6 9 7 15 2 3 12 17 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 3 4 6 23 1 1 3 4 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
104 140 226 137
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 155 131 251
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 197 221 154
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (13.14%)
Alanine (Ala, A)
n = 12 (6.86%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 10 (5.71%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 21 (12.0%)
Leucine (Leu, L)
n = 20 (11.43%)
Isoleucine (Ile, I)
n = 16 (9.14%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 12 (6.86%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 7 (4.0%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 2 3 1 0 1 2 8 1 0 5 1 9 6 12 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 0 5 4 1 2 13 1 3 6 2 0 0 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 1 4 0 2 0 4 1 7 2 2 8 3 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 5 4 1 2 2 1 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 9 49 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 31 31 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 13 38 83
Total protein-coding genes (size: 11404 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 214 (5.63%)
Alanine (Ala, A)
n = 246 (6.48%)
Serine (Ser, S)
n = 286 (7.53%)
Threonine (Thr, T)
n = 311 (8.19%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 179 (4.71%)
Leucine (Leu, L)
n = 595 (15.67%)
Isoleucine (Ile, I)
n = 348 (9.16%)
Methionine (Met, M)
n = 250 (6.58%)
Proline (Pro, P)
n = 193 (5.08%)
Phenylalanine (Phe, F)
n = 233 (6.13%)
Tyrosine (Tyr, Y)
n = 140 (3.69%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 153 (4.03%)
Glutamine (Gln, Q)
n = 91 (2.4%)
Histidine (His, H)
n = 95 (2.5%)
Lysine (Lys, K)
n = 102 (2.69%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
193 155 204 105 82 212 34 138 75 16 42 25 90 22 125 108
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
46 11 14 60 83 95 8 48 47 90 29 64 55 67 7 88
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
86 127 10 79 56 86 11 22 32 69 71 10 24 70 83 47
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
48 77 18 26 40 91 11 5 11 46 3 1 0 7 0 94
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
800 877 1219 903
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
463 982 749 1605
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
249 996 1500 1054

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.