Viewing data for Cephalophus nigrifrons


Scientific name Cephalophus nigrifrons
Common name Black-fronted duiker
Maximum lifespan 17.90 years (Cephalophus nigrifrons@AnAge)

Total mtDNA (size: 16431 bases) GC AT G C A T
Base content (bases) 6665 9741 4420 2245 4324 5417
Base content per 1 kb (bases) 406 593 269 137 263 330
Base content (%) 40.6% 59.3%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4651 6668 3247 1404 3049 3619
Base content per 1 kb (bases) 410 588 286 124 269 319
Base content (%) 41.0% 58.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1510 bases) GC AT G C A T
Base content (bases) 559 951 328 231 414 537
Base content per 1 kb (bases) 370 630 217 153 274 356
Base content (%) 37.0% 63.0%
Total rRNA-coding genes (size: 2525 bases) GC AT G C A T
Base content (bases) 1004 1521 567 437 575 946
Base content per 1 kb (bases) 398 602 225 173 228 375
Base content (%) 39.8% 60.2%
12S rRNA gene (size: 953 bases) GC AT G C A T
Base content (bases) 388 565 222 166 215 350
Base content per 1 kb (bases) 407 593 233 174 226 367
Base content (%) 40.7% 59.3%
16S rRNA gene (size: 1572 bases) GC AT G C A T
Base content (bases) 616 956 345 271 360 596
Base content per 1 kb (bases) 392 608 219 172 229 379
Base content (%) 39.2% 60.8%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 282 397 199 83 188 209
Base content per 1 kb (bases) 414 583 292 122 276 307
Base content (%) 41.4% 58.3%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 65 136 50 15 57 79
Base content per 1 kb (bases) 323 677 249 75 284 393
Base content (%) 32.3% 67.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 637 906 386 251 465 441
Base content per 1 kb (bases) 412 586 250 162 301 285
Base content (%) 41.2% 58.6%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 269 413 169 100 175 238
Base content per 1 kb (bases) 393 604 247 146 256 348
Base content (%) 39.3% 60.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 350 427 235 115 221 206
Base content per 1 kb (bases) 446 545 300 147 282 263
Base content (%) 44.6% 54.5%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 506 633 346 160 288 345
Base content per 1 kb (bases) 444 555 304 140 253 303
Base content (%) 44.4% 55.5%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 407 549 283 124 260 289
Base content per 1 kb (bases) 426 574 296 130 272 302
Base content (%) 42.6% 57.4%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 394 648 301 93 271 377
Base content per 1 kb (bases) 378 622 289 89 260 362
Base content (%) 37.8% 62.2%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 155 191 113 42 86 105
Base content per 1 kb (bases) 448 552 327 121 249 303
Base content (%) 44.8% 55.2%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 566 807 411 155 365 442
Base content per 1 kb (bases) 411 586 298 112 265 321
Base content (%) 41.1% 58.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 111 186 78 33 91 95
Base content per 1 kb (bases) 374 626 263 111 306 320
Base content (%) 37.4% 62.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 733 1088 533 200 494 594
Base content per 1 kb (bases) 403 597 293 110 271 326
Base content (%) 40.3% 59.7%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 196 332 157 39 110 222
Base content per 1 kb (bases) 371 629 297 74 208 420
Base content (%) 37.1% 62.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 23 (10.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 47 (20.8%)
Isoleucine (Ile, I)
n = 22 (9.73%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 6 9 5 8 26 4 3 8 1 4 4 2 2 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 8 4 1 1 4 5 1 3 3 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 15 0 1 2 6 0 0 5 1 1 1 1 7 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 1 0 1 3 1 1 1 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 75 75 31
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 62 36 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 62 95 53
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLVLFIIFQLKISKHNFYLSPELVLMKTSKQNTPWETKWTKIYLPLSLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 6 (9.09%)
Threonine (Thr, T)
n = 7 (10.61%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.03%)
Leucine (Leu, L)
n = 13 (19.7%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 4 (6.06%)
Proline (Pro, P)
n = 5 (7.58%)
Phenylalanine (Phe, F)
n = 4 (6.06%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 2 (3.03%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 1 (1.52%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 3 4 0 5 1 2 3 0 0 1 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 2 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 4 2 0 0 5 0 0 1 1 1 0 1 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 5 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 19 25 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 17 18 28
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 14 36 11
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 39 (7.59%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 39 (7.59%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 17 29 7 7 21 9 16 4 2 6 6 18 6 11 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 14 9 14 2 11 9 23 4 10 9 8 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 17 0 11 4 12 0 2 1 8 11 0 0 9 10 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 0 3 12 9 0 0 2 6 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
146 103 142 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 95 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 150 204 131
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 10 12 2 3 18 5 6 6 0 0 3 6 2 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 0 2 5 1 1 2 3 2 0 3 8 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 10 2 4 5 7 0 2 3 7 4 0 0 3 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 14 1 3 7 3 3 1 0 4 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 59 68 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 54 61 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 54 108 42
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 16 (6.15%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 4 8 6 8 13 0 5 7 0 3 7 5 1 10 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 0 12 4 0 5 7 7 1 2 4 4 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 9 1 4 2 8 0 2 2 2 7 1 0 2 5 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 5 2 1 2 2 0 0 3 2 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 67 59 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 64 52 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 101 90 54
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 28 (7.39%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 38 (10.03%)
Methionine (Met, M)
n = 17 (4.49%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 26 (6.86%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 26 11 4 16 23 4 7 6 0 1 8 6 3 11 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 4 1 10 14 1 1 8 11 4 1 5 15 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 16 0 2 6 11 0 0 3 6 10 0 1 3 15 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 5 1 1 10 7 2 0 0 8 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 95 114 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 95 78 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 155 153 48
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 22 (6.94%)
Threonine (Thr, T)
n = 21 (6.62%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 16 (5.05%)
Leucine (Leu, L)
n = 55 (17.35%)
Isoleucine (Ile, I)
n = 29 (9.15%)
Methionine (Met, M)
n = 18 (5.68%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 21 (6.62%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 13 13 5 9 25 7 9 7 0 2 6 7 1 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 1 10 13 4 1 6 4 1 5 9 8 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 14 0 1 8 10 0 0 3 4 8 2 0 4 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 10 1 1 2 7 0 0 1 7 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 86 91 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 90 56 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 107 141 49
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 36 (10.4%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 23 38 5 8 34 3 6 10 0 3 6 4 0 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 7 8 0 1 4 8 1 2 8 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 16 1 3 10 12 2 0 2 3 5 1 0 4 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 1 1 13 0 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 87 144 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 100 58 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 114 175 46
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 18 (5.2%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 36 (10.4%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 36 (10.4%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 23 38 5 8 34 3 6 10 0 3 6 4 0 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 7 8 0 1 4 8 1 2 8 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 16 1 3 10 12 2 0 2 3 5 1 0 4 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 1 1 13 0 0 0 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 87 144 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 100 58 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 114 175 46
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 27 (5.9%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 37 (8.08%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 18 (3.93%)
Leucine (Leu, L)
n = 95 (20.74%)
Isoleucine (Ile, I)
n = 39 (8.52%)
Methionine (Met, M)
n = 35 (7.64%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 20 (4.37%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 24 (5.24%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 22 29 12 15 50 8 9 11 0 3 8 7 0 7 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 2 0 12 15 0 3 5 7 2 1 12 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 21 5 7 13 6 1 2 9 5 10 3 0 7 17 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 0 2 2 11 0 0 3 7 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 138 155 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 113 83 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 159 200 70
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 11 (11.22%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 9 1 2 13 1 5 2 0 0 1 5 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 2 2 3 0 1 1 2 0 0 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 4 0 1 5 3 0 0 1 2 1 0 1 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 23 29 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 24 16 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 31 50 14
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 38 (6.27%)
Serine (Ser, S)
n = 50 (8.25%)
Threonine (Thr, T)
n = 58 (9.57%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 16 (2.64%)
Leucine (Leu, L)
n = 89 (14.69%)
Isoleucine (Ile, I)
n = 60 (9.9%)
Methionine (Met, M)
n = 42 (6.93%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 47 (7.76%)
Tyrosine (Tyr, Y)
n = 20 (3.3%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 34 (5.61%)
Glutamine (Gln, Q)
n = 18 (2.97%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 34 36 9 19 43 7 11 16 2 4 8 4 0 19 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 2 1 14 22 1 3 9 13 3 7 10 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 24 5 6 17 12 1 5 9 8 12 2 0 9 25 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 1 3 8 21 1 1 3 3 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
104 142 230 131
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 158 129 254
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 233 235 109
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 9 (5.14%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 25 (14.29%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 15 (8.57%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 1 4 0 0 0 1 9 1 0 11 0 5 9 12 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 4 0 1 1 11 2 2 11 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 2 4 1 2 0 4 0 9 1 2 8 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 3 1 0 4 1 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 6 46 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 25 33 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
51 8 31 86
Total protein-coding genes (size: 11403 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 242 (6.37%)
Serine (Ser, S)
n = 279 (7.35%)
Threonine (Thr, T)
n = 316 (8.32%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 193 (5.08%)
Leucine (Leu, L)
n = 606 (15.96%)
Isoleucine (Ile, I)
n = 326 (8.58%)
Methionine (Met, M)
n = 255 (6.71%)
Proline (Pro, P)
n = 192 (5.06%)
Phenylalanine (Phe, F)
n = 242 (6.37%)
Tyrosine (Tyr, Y)
n = 132 (3.48%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 162 (4.27%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 93 (2.45%)
Lysine (Lys, K)
n = 96 (2.53%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
155 167 207 61 104 285 52 89 84 5 38 58 72 24 96 145
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
48 5 17 32 93 106 11 39 57 88 30 36 70 80 4 44
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
97 156 19 45 73 97 4 18 40 57 73 13 13 54 107 24
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
68 80 14 18 50 84 12 4 14 43 2 1 0 7 0 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
810 936 1209 825
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
462 967 737 1614
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
251 1233 1570 726

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.