Viewing data for Ichthyomyzon unicuspis


Scientific name Ichthyomyzon unicuspis
Common name Silver lamprey
Maximum lifespan 8.00 years (Ichthyomyzon unicuspis@AnAge)

Total mtDNA (size: 16163 bases) GC AT G C A T
Base content (bases) 5989 10174 3918 2071 4788 5386
Base content per 1 kb (bases) 371 629 242 128 296 333
Base content (%) 37.1% 62.9%
Total protein-coding genes (size: 11369 bases) GC AT G C A T
Base content (bases) 4178 7191 2862 1316 3493 3698
Base content per 1 kb (bases) 367 633 252 116 307 325
Base content (%) 36.7% 63.3%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1531 bases) GC AT G C A T
Base content (bases) 574 957 337 237 439 518
Base content per 1 kb (bases) 375 625 220 155 287 338
Base content (%) 37.5% 62.5%
Total rRNA-coding genes (size: 2511 bases) GC AT G C A T
Base content (bases) 989 1522 558 431 602 920
Base content per 1 kb (bases) 394 606 222 172 240 366
Base content (%) 39.4% 60.6%
12S rRNA gene (size: 892 bases) GC AT G C A T
Base content (bases) 390 502 229 161 200 302
Base content per 1 kb (bases) 437 563 257 180 224 339
Base content (%) 43.7% 56.3%
16S rRNA gene (size: 1619 bases) GC AT G C A T
Base content (bases) 599 1020 329 270 402 618
Base content per 1 kb (bases) 370 630 203 167 248 382
Base content (%) 37.0% 63.0%

ATP6 (size: 679 bases) GC AT G C A T
Base content (bases) 232 447 175 57 222 225
Base content per 1 kb (bases) 342 658 258 84 327 331
Base content (%) 34.2% 65.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 63 105 51 12 48 57
Base content per 1 kb (bases) 375 625 304 71 286 339
Base content (%) 37.5% 62.5%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 607 950 370 237 490 460
Base content per 1 kb (bases) 390 610 238 152 315 295
Base content (%) 39.0% 61.0%
COX2 (size: 690 bases) GC AT G C A T
Base content (bases) 257 433 168 89 204 229
Base content per 1 kb (bases) 372 628 243 129 296 332
Base content (%) 37.2% 62.8%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 328 458 212 116 234 224
Base content per 1 kb (bases) 417 583 270 148 298 285
Base content (%) 41.7% 58.3%
CYTB (size: 1182 bases) GC AT G C A T
Base content (bases) 434 748 285 149 388 360
Base content per 1 kb (bases) 367 633 241 126 328 305
Base content (%) 36.7% 63.3%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 350 616 232 118 319 297
Base content per 1 kb (bases) 362 638 240 122 330 307
Base content (%) 36.2% 63.8%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 351 691 251 100 332 359
Base content per 1 kb (bases) 337 663 241 96 319 345
Base content (%) 33.7% 66.3%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 135 216 92 43 116 100
Base content per 1 kb (bases) 385 615 262 123 330 285
Base content (%) 38.5% 61.5%
ND4 (size: 1374 bases) GC AT G C A T
Base content (bases) 478 896 346 132 444 452
Base content per 1 kb (bases) 348 652 252 96 323 329
Base content (%) 34.8% 65.2%
ND4L (size: 291 bases) GC AT G C A T
Base content (bases) 120 171 88 32 83 88
Base content per 1 kb (bases) 412 588 302 110 285 302
Base content (%) 41.2% 58.8%
ND5 (size: 1797 bases) GC AT G C A T
Base content (bases) 630 1167 445 185 550 617
Base content per 1 kb (bases) 351 649 248 103 306 343
Base content (%) 35.1% 64.9%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 209 310 156 53 70 240
Base content per 1 kb (bases) 403 597 301 102 135 462
Base content (%) 40.3% 59.7%

ATP6 (size: 679 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.56%)
Alanine (Ala, A)
n = 15 (6.67%)
Serine (Ser, S)
n = 12 (5.33%)
Threonine (Thr, T)
n = 23 (10.22%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 7 (3.11%)
Leucine (Leu, L)
n = 49 (21.78%)
Isoleucine (Ile, I)
n = 31 (13.78%)
Methionine (Met, M)
n = 15 (6.67%)
Proline (Pro, P)
n = 15 (6.67%)
Phenylalanine (Phe, F)
n = 8 (3.56%)
Tyrosine (Tyr, Y)
n = 5 (2.22%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 2 (0.89%)
Glutamic acid (Glu, E)
n = 5 (2.22%)
Asparagine (Asn, N)
n = 5 (2.22%)
Glutamine (Gln, Q)
n = 9 (4.0%)
Histidine (His, H)
n = 4 (1.78%)
Lysine (Lys, K)
n = 6 (2.67%)
Arginine (Arg, R)
n = 3 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 14 14 9 5 16 1 18 9 0 2 2 3 0 7 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 4 8 3 0 2 1 5 0 4 2 9 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 9 0 3 2 4 0 1 2 4 1 0 0 2 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 0 1 1 6 0 0 1 2 0 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 62 83 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
18 62 36 110
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 51 106 67
ATP8 (size: 168 bases)
Amino acid sequence: MPQLDPAPWLYMFTVSWLIILLLIMPTILFYQPQNTIPTQQTTKSEQPTWTWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 8 (14.55%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 2 (3.64%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 1 (1.82%)
Glutamine (Gln, Q)
n = 6 (10.91%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 1 (1.82%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 2 2 2 3 0 0 5 1 0 0 1 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 0 0 0 2 2 4 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 1 0 1 0 0 0 1 1 0 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 1 0 1 0 0 0 0 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 22 18 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 19 14 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 10 25 18
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 44 (8.49%)
Alanine (Ala, A)
n = 44 (8.49%)
Serine (Ser, S)
n = 27 (5.21%)
Threonine (Thr, T)
n = 44 (8.49%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 31 (5.98%)
Leucine (Leu, L)
n = 64 (12.36%)
Isoleucine (Ile, I)
n = 44 (8.49%)
Methionine (Met, M)
n = 27 (5.21%)
Proline (Pro, P)
n = 28 (5.41%)
Phenylalanine (Phe, F)
n = 41 (7.92%)
Tyrosine (Tyr, Y)
n = 19 (3.67%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 14 (2.7%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 18 (3.47%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 20 (3.86%)
Lysine (Lys, K)
n = 11 (2.12%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 10 25 16 4 19 3 22 7 0 13 6 10 2 18 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 17 15 12 0 1 6 26 11 4 6 18 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 20 0 5 5 12 0 1 4 12 7 0 0 8 10 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 0 6 8 10 1 4 0 4 0 1 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
142 105 150 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 138 98 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 127 212 161
COX2 (size: 690 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 10 (4.37%)
Serine (Ser, S)
n = 15 (6.55%)
Threonine (Thr, T)
n = 23 (10.04%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 16 (6.99%)
Leucine (Leu, L)
n = 24 (10.48%)
Isoleucine (Ile, I)
n = 24 (10.48%)
Methionine (Met, M)
n = 11 (4.8%)
Proline (Pro, P)
n = 13 (5.68%)
Phenylalanine (Phe, F)
n = 10 (4.37%)
Tyrosine (Tyr, Y)
n = 7 (3.06%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 10 (4.37%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 7 (3.06%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 7 10 7 3 8 2 4 9 0 5 1 10 0 4 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 2 3 5 0 5 1 3 0 3 3 6 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 12 0 6 4 2 0 2 1 3 4 0 0 5 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 13 1 2 8 4 0 2 1 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
59 58 72 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 58 62 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 52 95 78
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.28%)
Alanine (Ala, A)
n = 20 (7.66%)
Serine (Ser, S)
n = 16 (6.13%)
Threonine (Thr, T)
n = 23 (8.81%)
Cysteine (Cys, C)
n = 3 (1.15%)
Valine (Val, V)
n = 15 (5.75%)
Leucine (Leu, L)
n = 33 (12.64%)
Isoleucine (Ile, I)
n = 13 (4.98%)
Methionine (Met, M)
n = 15 (5.75%)
Proline (Pro, P)
n = 11 (4.21%)
Phenylalanine (Phe, F)
n = 19 (7.28%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 4 (1.53%)
Glutamic acid (Glu, E)
n = 9 (3.45%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 7 (2.68%)
Histidine (His, H)
n = 17 (6.51%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 6 13 8 5 9 2 9 7 0 8 3 4 0 11 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 8 7 5 0 2 10 6 1 1 3 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 10 0 4 2 7 0 2 1 4 8 0 0 3 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 1 2 2 3 0 1 0 3 1 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 64 62 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 67 58 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 81 104 70
CYTB (size: 1182 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.36%)
Alanine (Ala, A)
n = 26 (6.62%)
Serine (Ser, S)
n = 28 (7.12%)
Threonine (Thr, T)
n = 26 (6.62%)
Cysteine (Cys, C)
n = 2 (0.51%)
Valine (Val, V)
n = 15 (3.82%)
Leucine (Leu, L)
n = 55 (13.99%)
Isoleucine (Ile, I)
n = 42 (10.69%)
Methionine (Met, M)
n = 21 (5.34%)
Proline (Pro, P)
n = 22 (5.6%)
Phenylalanine (Phe, F)
n = 28 (7.12%)
Tyrosine (Tyr, Y)
n = 16 (4.07%)
Tryptophan (Trp, W)
n = 11 (2.8%)
Aspartic acid (Asp, D)
n = 8 (2.04%)
Glutamic acid (Glu, E)
n = 7 (1.78%)
Asparagine (Asn, N)
n = 22 (5.6%)
Glutamine (Gln, Q)
n = 10 (2.54%)
Histidine (His, H)
n = 11 (2.8%)
Lysine (Lys, K)
n = 10 (2.54%)
Arginine (Arg, R)
n = 8 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 14 18 11 8 19 1 14 9 1 5 4 6 0 17 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 7 13 6 0 2 6 13 4 7 3 11 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 12 0 10 3 9 0 3 3 8 8 0 2 13 9 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 7 0 5 3 8 2 2 1 5 0 0 1 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 90 128 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 96 84 161
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 99 148 132
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.92%)
Alanine (Ala, A)
n = 23 (7.17%)
Serine (Ser, S)
n = 21 (6.54%)
Threonine (Thr, T)
n = 29 (9.03%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 17 (5.3%)
Leucine (Leu, L)
n = 58 (18.07%)
Isoleucine (Ile, I)
n = 25 (7.79%)
Methionine (Met, M)
n = 19 (5.92%)
Proline (Pro, P)
n = 17 (5.3%)
Phenylalanine (Phe, F)
n = 22 (6.85%)
Tyrosine (Tyr, Y)
n = 9 (2.8%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 10 (3.12%)
Asparagine (Asn, N)
n = 15 (4.67%)
Glutamine (Gln, Q)
n = 8 (2.49%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 8 (2.49%)
Arginine (Arg, R)
n = 7 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 11 16 10 7 15 1 25 8 0 5 4 8 0 13 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 5 6 11 1 3 6 10 0 4 8 4 1 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 0 5 5 9 0 0 2 4 5 2 0 12 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 1 2 1 8 0 2 0 5 0 0 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 67 98 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 88 56 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 77 143 93
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.62%)
Alanine (Ala, A)
n = 23 (6.65%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 4 (1.16%)
Valine (Val, V)
n = 4 (1.16%)
Leucine (Leu, L)
n = 62 (17.92%)
Isoleucine (Ile, I)
n = 41 (11.85%)
Methionine (Met, M)
n = 22 (6.36%)
Proline (Pro, P)
n = 18 (5.2%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 19 (5.49%)
Glutamine (Gln, Q)
n = 12 (3.47%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 7 21 18 6 16 3 17 12 0 0 0 3 1 11 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 3 1 6 10 7 0 4 7 5 0 3 2 13 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 23 0 4 2 12 0 6 2 2 5 1 2 11 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 2 1 11 0 1 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 83 142 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 100 62 143
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 68 155 116
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.62%)
Alanine (Ala, A)
n = 23 (6.65%)
Serine (Ser, S)
n = 26 (7.51%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 4 (1.16%)
Valine (Val, V)
n = 4 (1.16%)
Leucine (Leu, L)
n = 62 (17.92%)
Isoleucine (Ile, I)
n = 41 (11.85%)
Methionine (Met, M)
n = 22 (6.36%)
Proline (Pro, P)
n = 18 (5.2%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 19 (5.49%)
Glutamine (Gln, Q)
n = 12 (3.47%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 7 21 18 6 16 3 17 12 0 0 0 3 1 11 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 3 1 6 10 7 0 4 7 5 0 3 2 13 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 23 0 4 2 12 0 6 2 2 5 1 2 11 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 2 1 11 0 1 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 83 142 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 100 62 143
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 68 155 116
ND4 (size: 1374 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (3.06%)
Alanine (Ala, A)
n = 30 (6.56%)
Serine (Ser, S)
n = 39 (8.53%)
Threonine (Thr, T)
n = 42 (9.19%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 78 (17.07%)
Isoleucine (Ile, I)
n = 50 (10.94%)
Methionine (Met, M)
n = 39 (8.53%)
Proline (Pro, P)
n = 25 (5.47%)
Phenylalanine (Phe, F)
n = 25 (5.47%)
Tyrosine (Tyr, Y)
n = 9 (1.97%)
Tryptophan (Trp, W)
n = 14 (3.06%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 10 (2.19%)
Asparagine (Asn, N)
n = 22 (4.81%)
Glutamine (Gln, Q)
n = 8 (1.75%)
Histidine (His, H)
n = 11 (2.41%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 19 36 11 10 28 3 25 8 0 4 0 3 2 16 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 3 12 9 7 2 1 6 4 3 4 6 15 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 17 0 6 9 17 0 4 3 5 4 0 1 10 12 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 10 0 1 2 13 0 3 3 4 0 1 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 106 174 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 129 76 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 111 202 131
ND4L (size: 291 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.13%)
Alanine (Ala, A)
n = 11 (11.46%)
Serine (Ser, S)
n = 8 (8.33%)
Threonine (Thr, T)
n = 11 (11.46%)
Cysteine (Cys, C)
n = 2 (2.08%)
Valine (Val, V)
n = 2 (2.08%)
Leucine (Leu, L)
n = 25 (26.04%)
Isoleucine (Ile, I)
n = 5 (5.21%)
Methionine (Met, M)
n = 5 (5.21%)
Proline (Pro, P)
n = 3 (3.13%)
Phenylalanine (Phe, F)
n = 4 (4.17%)
Tyrosine (Tyr, Y)
n = 1 (1.04%)
Tryptophan (Trp, W)
n = 1 (1.04%)
Aspartic acid (Asp, D)
n = 1 (1.04%)
Glutamic acid (Glu, E)
n = 2 (2.08%)
Asparagine (Asn, N)
n = 3 (3.13%)
Glutamine (Gln, Q)
n = 2 (2.08%)
Histidine (His, H)
n = 2 (2.08%)
Lysine (Lys, K)
n = 3 (3.13%)
Arginine (Arg, R)
n = 2 (2.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 4 3 3 11 1 6 2 0 0 1 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 2 7 2 0 0 3 0 0 1 0 2 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 5 0 1 2 3 0 0 2 0 1 0 1 3 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 3 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 27 29 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 31 15 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 30 44 20
ND5 (size: 1797 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (4.01%)
Alanine (Ala, A)
n = 40 (6.69%)
Serine (Ser, S)
n = 49 (8.19%)
Threonine (Thr, T)
n = 60 (10.03%)
Cysteine (Cys, C)
n = 7 (1.17%)
Valine (Val, V)
n = 11 (1.84%)
Leucine (Leu, L)
n = 88 (14.72%)
Isoleucine (Ile, I)
n = 60 (10.03%)
Methionine (Met, M)
n = 45 (7.53%)
Proline (Pro, P)
n = 27 (4.52%)
Phenylalanine (Phe, F)
n = 36 (6.02%)
Tyrosine (Tyr, Y)
n = 13 (2.17%)
Tryptophan (Trp, W)
n = 13 (2.17%)
Aspartic acid (Asp, D)
n = 10 (1.67%)
Glutamic acid (Glu, E)
n = 13 (2.17%)
Asparagine (Asn, N)
n = 30 (5.02%)
Glutamine (Gln, Q)
n = 19 (3.18%)
Histidine (His, H)
n = 16 (2.68%)
Lysine (Lys, K)
n = 27 (4.52%)
Arginine (Arg, R)
n = 10 (1.67%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
42 18 42 14 11 41 4 17 18 1 6 1 4 0 24 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 4 13 13 14 0 6 4 13 1 8 5 12 2 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 25 0 14 6 14 2 4 9 6 7 3 1 17 13 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 12 1 7 3 27 0 3 3 4 0 0 1 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
98 142 236 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 163 128 240
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 140 253 187
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (11.63%)
Alanine (Ala, A)
n = 10 (5.81%)
Serine (Ser, S)
n = 10 (5.81%)
Threonine (Thr, T)
n = 4 (2.33%)
Cysteine (Cys, C)
n = 7 (4.07%)
Valine (Val, V)
n = 29 (16.86%)
Leucine (Leu, L)
n = 32 (18.6%)
Isoleucine (Ile, I)
n = 6 (3.49%)
Methionine (Met, M)
n = 8 (4.65%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 16 (9.3%)
Tyrosine (Tyr, Y)
n = 9 (5.23%)
Tryptophan (Trp, W)
n = 3 (1.74%)
Aspartic acid (Asp, D)
n = 4 (2.33%)
Glutamic acid (Glu, E)
n = 4 (2.33%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 0 1 3 1 1 2 13 0 1 15 1 5 8 16 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 6 1 6 3 1 0 5 2 1 12 3 0 0 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 3 4 2 0 1 3 0 9 0 2 12 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 2 2 2 0 0 1 0 1 1 1 0 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 16 23 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 25 20 91
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 12 27 82
Total protein-coding genes (size: 11402 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 206 (5.42%)
Alanine (Ala, A)
n = 261 (6.87%)
Serine (Ser, S)
n = 262 (6.9%)
Threonine (Thr, T)
n = 341 (8.98%)
Cysteine (Cys, C)
n = 37 (0.97%)
Valine (Val, V)
n = 159 (4.19%)
Leucine (Leu, L)
n = 600 (15.79%)
Isoleucine (Ile, I)
n = 354 (9.32%)
Methionine (Met, M)
n = 237 (6.24%)
Proline (Pro, P)
n = 198 (5.21%)
Phenylalanine (Phe, F)
n = 236 (6.21%)
Tyrosine (Tyr, Y)
n = 111 (2.92%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 94 (2.47%)
Asparagine (Asn, N)
n = 150 (3.95%)
Glutamine (Gln, Q)
n = 100 (2.63%)
Histidine (His, H)
n = 102 (2.68%)
Lysine (Lys, K)
n = 99 (2.61%)
Arginine (Arg, R)
n = 68 (1.79%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
242 112 207 115 70 196 24 176 96 4 64 23 59 13 146 90
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
30 22 15 84 97 77 3 32 54 88 32 44 41 107 6 103
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
91 144 3 67 44 92 3 26 30 59 52 8 19 86 64 40
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
62 87 7 34 33 96 3 20 11 35 2 3 2 5 1 99
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
787 873 1242 898
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
479 1006 729 1586
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
160 889 1567 1184

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.