Viewing data for Callosciurus erythraeus


Scientific name Callosciurus erythraeus
Common name Pallas's squirrel
Maximum lifespan 17.00 years (Callosciurus erythraeus@AnAge)

Total mtDNA (size: 16550 bases) GC AT G C A T
Base content (bases) 6502 10048 4344 2158 4858 5190
Base content per 1 kb (bases) 393 607 262 130 294 314
Base content (%) 39.3% 60.7%
Total protein-coding genes (size: 11332 bases) GC AT G C A T
Base content (bases) 4520 6812 3167 1353 3405 3407
Base content per 1 kb (bases) 399 601 279 119 300 301
Base content (%) 39.9% 60.1%
D-loop (size: 1081 bases) GC AT G C A T
Base content (bases) 399 682 274 125 352 330
Base content per 1 kb (bases) 369 631 253 116 326 305
Base content (%) 36.9% 63.1%
Total tRNA-coding genes (size: 1513 bases) GC AT G C A T
Base content (bases) 550 963 323 227 442 521
Base content per 1 kb (bases) 364 636 213 150 292 344
Base content (%) 36.4% 63.6%
Total rRNA-coding genes (size: 2547 bases) GC AT G C A T
Base content (bases) 1000 1547 560 440 637 910
Base content per 1 kb (bases) 393 607 220 173 250 357
Base content (%) 39.3% 60.7%
12S rRNA gene (size: 969 bases) GC AT G C A T
Base content (bases) 398 571 223 175 236 335
Base content per 1 kb (bases) 411 589 230 181 244 346
Base content (%) 41.1% 58.9%
16S rRNA gene (size: 1578 bases) GC AT G C A T
Base content (bases) 602 976 337 265 401 575
Base content per 1 kb (bases) 381 619 214 168 254 364
Base content (%) 38.1% 61.9%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 275 406 209 66 193 213
Base content per 1 kb (bases) 404 596 307 97 283 313
Base content (%) 40.4% 59.6%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 75 129 62 13 59 70
Base content per 1 kb (bases) 368 632 304 64 289 343
Base content (%) 36.8% 63.2%
COX1 (size: 1542 bases) GC AT G C A T
Base content (bases) 625 917 370 255 494 423
Base content per 1 kb (bases) 405 595 240 165 320 274
Base content (%) 40.5% 59.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 267 417 173 94 208 209
Base content per 1 kb (bases) 390 610 253 137 304 306
Base content (%) 39.0% 61.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 338 446 217 121 247 199
Base content per 1 kb (bases) 431 569 277 154 315 254
Base content (%) 43.1% 56.9%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 505 635 359 146 331 304
Base content per 1 kb (bases) 443 557 315 128 290 267
Base content (%) 44.3% 55.7%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 394 563 281 113 283 280
Base content per 1 kb (bases) 412 588 294 118 296 293
Base content (%) 41.2% 58.8%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 397 645 303 94 287 358
Base content per 1 kb (bases) 381 619 291 90 275 344
Base content (%) 38.1% 61.9%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 132 216 90 42 116 100
Base content per 1 kb (bases) 379 621 259 121 333 287
Base content (%) 37.9% 62.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 519 859 376 143 430 429
Base content per 1 kb (bases) 377 623 273 104 312 311
Base content (%) 37.7% 62.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 110 187 75 35 100 87
Base content per 1 kb (bases) 370 630 253 118 337 293
Base content (%) 37.0% 63.0%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 707 1111 508 199 567 544
Base content per 1 kb (bases) 389 611 279 109 312 299
Base content (%) 38.9% 61.1%
ND6 (size: 525 bases) GC AT G C A T
Base content (bases) 200 325 162 38 110 215
Base content per 1 kb (bases) 381 619 309 72 210 410
Base content (%) 38.1% 61.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.1%)
Leucine (Leu, L)
n = 44 (19.47%)
Isoleucine (Ile, I)
n = 28 (12.39%)
Methionine (Met, M)
n = 15 (6.64%)
Proline (Pro, P)
n = 15 (6.64%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 13 13 5 8 18 4 9 8 0 1 3 3 0 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 7 4 1 0 6 5 0 6 4 5 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 0 3 3 4 0 0 3 1 1 0 0 3 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 1 0 4 0 0 2 3 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 70 83 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 62 37 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 77 93 50
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWLTTIISMFLALFILFQVKISNHPFPSNPSSKDMALTHYKTPWENKWTKIYLPLSLPLQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (2.99%)
Serine (Ser, S)
n = 7 (10.45%)
Threonine (Thr, T)
n = 7 (10.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.49%)
Leucine (Leu, L)
n = 10 (14.93%)
Isoleucine (Ile, I)
n = 5 (7.46%)
Methionine (Met, M)
n = 3 (4.48%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 4 (5.97%)
Tyrosine (Tyr, Y)
n = 2 (2.99%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 2 (2.99%)
Glutamic acid (Glu, E)
n = 1 (1.49%)
Asparagine (Asn, N)
n = 3 (4.48%)
Glutamine (Gln, Q)
n = 3 (4.48%)
Histidine (His, H)
n = 2 (2.99%)
Lysine (Lys, K)
n = 5 (7.46%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 2 1 2 5 0 1 2 1 1 0 0 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 1 0 0 0 0 0 4 3 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 1 2 1 4 0 0 0 1 1 0 1 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 0 1 1 5 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 20 23 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 23 19 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 19 28 17
COX1 (size: 1542 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.16%)
Alanine (Ala, A)
n = 40 (7.8%)
Serine (Ser, S)
n = 31 (6.04%)
Threonine (Thr, T)
n = 36 (7.02%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.6%)
Leucine (Leu, L)
n = 60 (11.7%)
Isoleucine (Ile, I)
n = 37 (7.21%)
Methionine (Met, M)
n = 33 (6.43%)
Proline (Pro, P)
n = 28 (5.46%)
Phenylalanine (Phe, F)
n = 42 (8.19%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.12%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 16 (3.12%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 18 (3.51%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 12 31 7 9 25 4 15 5 1 6 9 21 3 27 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 15 12 11 2 8 8 25 6 15 10 3 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 11 1 7 7 12 2 2 1 10 9 2 0 6 10 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 4 8 8 9 0 4 0 4 0 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 105 134 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 132 95 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 133 194 160
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 22 (9.69%)
Threonine (Thr, T)
n = 17 (7.49%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 10 11 14 2 13 0 5 6 0 3 4 4 0 6 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 3 2 1 2 2 3 1 2 7 2 4 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 6 2 6 4 7 0 1 4 6 5 0 0 3 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 12 3 4 8 5 0 1 1 3 1 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 62 64 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 56 62 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 55 83 76
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 23 (8.85%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 10 (3.85%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 9 (3.46%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 1 (0.38%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 5 6 10 4 11 3 4 7 0 4 6 5 1 8 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 3 9 2 1 4 7 8 1 2 5 3 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 0 7 3 6 2 1 4 5 5 0 2 4 5 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 8 0 3 0 1 0 1 2 1 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 66 63 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 54 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 86 82 78
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 15 (3.96%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 29 (7.65%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 28 13 12 13 24 4 7 4 2 2 8 4 1 7 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 4 13 6 0 4 10 10 0 7 12 2 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 0 5 9 6 1 2 2 6 9 2 0 3 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 0 6 5 9 1 1 3 4 0 1 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 102 111 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 91 76 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 166 117 83
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.09%)
Alanine (Ala, A)
n = 27 (8.49%)
Serine (Ser, S)
n = 22 (6.92%)
Threonine (Thr, T)
n = 26 (8.18%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 9 (2.83%)
Leucine (Leu, L)
n = 59 (18.55%)
Isoleucine (Ile, I)
n = 25 (7.86%)
Methionine (Met, M)
n = 23 (7.23%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 22 (6.92%)
Tyrosine (Tyr, Y)
n = 9 (2.83%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 10 (3.14%)
Asparagine (Asn, N)
n = 12 (3.77%)
Glutamine (Gln, Q)
n = 8 (2.52%)
Histidine (His, H)
n = 2 (0.63%)
Lysine (Lys, K)
n = 8 (2.52%)
Arginine (Arg, R)
n = 7 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 12 21 6 11 25 6 9 6 2 4 4 1 0 10 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 3 13 10 1 3 4 6 0 6 9 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 11 0 8 6 5 1 0 2 5 4 0 2 7 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 8 2 0 3 7 1 0 1 6 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 87 96 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 95 53 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 99 131 71
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 21 (6.07%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 33 (9.54%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 60 (17.34%)
Isoleucine (Ile, I)
n = 39 (11.27%)
Methionine (Met, M)
n = 36 (10.4%)
Proline (Pro, P)
n = 22 (6.36%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 22 (6.36%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 23 34 12 16 19 3 6 9 0 1 2 2 2 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 6 8 7 0 1 4 7 2 3 9 10 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 13 1 3 6 16 0 1 2 3 4 0 4 8 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 1 0 11 2 1 0 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 88 146 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 101 61 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 114 151 66
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 21 (6.07%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 33 (9.54%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 60 (17.34%)
Isoleucine (Ile, I)
n = 39 (11.27%)
Methionine (Met, M)
n = 36 (10.4%)
Proline (Pro, P)
n = 22 (6.36%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 22 (6.36%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 4 (1.16%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 23 34 12 16 19 3 6 9 0 1 2 2 2 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 6 8 7 0 1 4 7 2 3 9 10 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 13 1 3 6 16 0 1 2 3 4 0 4 8 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 1 0 11 2 1 0 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 88 146 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 101 61 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 114 151 66
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 29 (6.33%)
Serine (Ser, S)
n = 48 (10.48%)
Threonine (Thr, T)
n = 31 (6.77%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 89 (19.43%)
Isoleucine (Ile, I)
n = 51 (11.14%)
Methionine (Met, M)
n = 36 (7.86%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 21 (4.59%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 23 29 17 15 33 4 19 10 0 1 6 3 0 11 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 1 8 11 10 0 2 2 11 2 8 10 4 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 18 1 8 10 17 2 0 11 9 6 2 1 8 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 0 2 3 9 2 3 0 7 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 121 161 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 119 80 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 136 188 114
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 11 (11.22%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 5 (5.1%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 5 7 2 4 7 1 5 2 0 0 1 4 1 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 2 4 1 0 0 1 3 0 2 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 1 0 3 1 4 0 0 1 3 2 0 1 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 21 31 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 21 18 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 33 38 22
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.46%)
Alanine (Ala, A)
n = 38 (6.28%)
Serine (Ser, S)
n = 60 (9.92%)
Threonine (Thr, T)
n = 47 (7.77%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 18 (2.98%)
Leucine (Leu, L)
n = 94 (15.54%)
Isoleucine (Ile, I)
n = 58 (9.59%)
Methionine (Met, M)
n = 35 (5.79%)
Proline (Pro, P)
n = 26 (4.3%)
Phenylalanine (Phe, F)
n = 46 (7.6%)
Tyrosine (Tyr, Y)
n = 25 (4.13%)
Tryptophan (Trp, W)
n = 13 (2.15%)
Aspartic acid (Asp, D)
n = 13 (2.15%)
Glutamic acid (Glu, E)
n = 10 (1.65%)
Asparagine (Asn, N)
n = 33 (5.45%)
Glutamine (Gln, Q)
n = 15 (2.48%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 31 31 13 25 36 7 12 12 3 4 3 10 1 21 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 2 4 17 16 1 6 9 12 0 9 11 6 0 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 18 2 19 17 12 3 4 5 15 10 2 1 13 20 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 6 4 5 8 20 3 1 3 5 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
106 142 205 153
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 162 131 251
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 204 208 163
ND6 (size: 525 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.94%)
Alanine (Ala, A)
n = 6 (3.45%)
Serine (Ser, S)
n = 13 (7.47%)
Threonine (Thr, T)
n = 6 (3.45%)
Cysteine (Cys, C)
n = 2 (1.15%)
Valine (Val, V)
n = 22 (12.64%)
Leucine (Leu, L)
n = 28 (16.09%)
Isoleucine (Ile, I)
n = 12 (6.9%)
Methionine (Met, M)
n = 9 (5.17%)
Proline (Pro, P)
n = 3 (1.72%)
Phenylalanine (Phe, F)
n = 9 (5.17%)
Tyrosine (Tyr, Y)
n = 10 (5.75%)
Tryptophan (Trp, W)
n = 4 (2.3%)
Aspartic acid (Asp, D)
n = 3 (1.72%)
Glutamic acid (Glu, E)
n = 14 (8.05%)
Asparagine (Asn, N)
n = 4 (2.3%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.57%)
Arginine (Arg, R)
n = 2 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 0 2 1 0 0 2 14 0 0 8 1 8 5 9 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 1 1 2 2 1 10 0 5 11 2 0 0 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 6 0 3 1 3 0 9 1 2 11 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 12 3 0 1 0 2 0 0 0 1 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 8 36 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 25 32 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 5 42 75
Total protein-coding genes (size: 11400 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 239 (6.29%)
Serine (Ser, S)
n = 307 (8.08%)
Threonine (Thr, T)
n = 283 (7.45%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 167 (4.4%)
Leucine (Leu, L)
n = 620 (16.32%)
Isoleucine (Ile, I)
n = 351 (9.24%)
Methionine (Met, M)
n = 243 (6.4%)
Proline (Pro, P)
n = 199 (5.24%)
Phenylalanine (Phe, F)
n = 239 (6.29%)
Tyrosine (Tyr, Y)
n = 133 (3.5%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 74 (1.95%)
Glutamic acid (Glu, E)
n = 98 (2.58%)
Asparagine (Asn, N)
n = 160 (4.21%)
Glutamine (Gln, Q)
n = 82 (2.16%)
Histidine (His, H)
n = 93 (2.45%)
Lysine (Lys, K)
n = 93 (2.45%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
184 167 205 105 118 222 38 112 73 9 35 49 69 14 121 118
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
38 10 14 54 100 76 9 40 56 95 24 72 79 44 4 70
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
91 114 8 78 69 98 12 14 36 74 59 11 25 63 97 35
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
58 73 25 36 38 84 9 14 12 37 2 2 0 6 2 93
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
793 922 1182 902
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
460 978 741 1620
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
230 1161 1403 1005

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.