Viewing data for Lethenteron reissneri


Scientific name Lethenteron reissneri
Common name Far eastern brook lamprey
Maximum lifespan 4.00 years (Lethenteron reissneri@AnAge)

Total mtDNA (size: 16461 bases) GC AT G C A T
Base content (bases) 6232 10229 3941 2291 4979 5250
Base content per 1 kb (bases) 379 621 239 139 302 319
Base content (%) 37.9% 62.1%
Total protein-coding genes (size: 11364 bases) GC AT G C A T
Base content (bases) 4248 7116 2809 1439 3569 3547
Base content per 1 kb (bases) 374 626 247 127 314 312
Base content (%) 37.4% 62.6%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1529 bases) GC AT G C A T
Base content (bases) 608 921 340 268 428 493
Base content per 1 kb (bases) 398 602 222 175 280 322
Base content (%) 39.8% 60.2%
Total rRNA-coding genes (size: 2515 bases) GC AT G C A T
Base content (bases) 1020 1495 567 453 614 881
Base content per 1 kb (bases) 406 594 225 180 244 350
Base content (%) 40.6% 59.4%
12S rRNA gene (size: 899 bases) GC AT G C A T
Base content (bases) 401 498 230 171 202 296
Base content per 1 kb (bases) 446 554 256 190 225 329
Base content (%) 44.6% 55.4%
16S rRNA gene (size: 1616 bases) GC AT G C A T
Base content (bases) 619 997 337 282 412 585
Base content per 1 kb (bases) 383 617 209 175 255 362
Base content (%) 38.3% 61.7%

ATP6 (size: 714 bases) GC AT G C A T
Base content (bases) 261 453 185 76 235 218
Base content per 1 kb (bases) 366 634 259 106 329 305
Base content (%) 36.6% 63.4%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 61 107 45 16 49 58
Base content per 1 kb (bases) 363 637 268 95 292 345
Base content (%) 36.3% 63.7%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 603 951 358 245 510 441
Base content per 1 kb (bases) 388 612 230 158 328 284
Base content (%) 38.8% 61.2%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 267 417 164 103 201 216
Base content per 1 kb (bases) 390 610 240 151 294 316
Base content (%) 39.0% 61.0%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 333 453 210 123 236 217
Base content per 1 kb (bases) 424 576 267 156 300 276
Base content (%) 42.4% 57.6%
CYTB (size: 1191 bases) GC AT G C A T
Base content (bases) 442 749 273 169 405 344
Base content per 1 kb (bases) 371 629 229 142 340 289
Base content (%) 37.1% 62.9%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 355 611 225 130 333 278
Base content per 1 kb (bases) 367 633 233 135 345 288
Base content (%) 36.7% 63.3%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 369 673 258 111 325 348
Base content per 1 kb (bases) 354 646 248 107 312 334
Base content (%) 35.4% 64.6%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 134 217 90 44 126 91
Base content per 1 kb (bases) 382 618 256 125 359 259
Base content (%) 38.2% 61.8%
ND4 (size: 1377 bases) GC AT G C A T
Base content (bases) 494 883 349 145 451 432
Base content per 1 kb (bases) 359 641 253 105 328 314
Base content (%) 35.9% 64.1%
ND4L (size: 291 bases) GC AT G C A T
Base content (bases) 108 183 79 29 89 94
Base content per 1 kb (bases) 371 629 271 100 306 323
Base content (%) 37.1% 62.9%
ND5 (size: 1797 bases) GC AT G C A T
Base content (bases) 661 1136 457 204 538 598
Base content per 1 kb (bases) 368 632 254 114 299 333
Base content (%) 36.8% 63.2%
ND6 (size: 495 bases) GC AT G C A T
Base content (bases) 184 311 131 53 81 230
Base content per 1 kb (bases) 372 628 265 107 164 465
Base content (%) 37.2% 62.8%

ATP6 (size: 714 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.8%)
Alanine (Ala, A)
n = 20 (8.44%)
Serine (Ser, S)
n = 12 (5.06%)
Threonine (Thr, T)
n = 22 (9.28%)
Cysteine (Cys, C)
n = 1 (0.42%)
Valine (Val, V)
n = 10 (4.22%)
Leucine (Leu, L)
n = 50 (21.1%)
Isoleucine (Ile, I)
n = 26 (10.97%)
Methionine (Met, M)
n = 14 (5.91%)
Proline (Pro, P)
n = 19 (8.02%)
Phenylalanine (Phe, F)
n = 10 (4.22%)
Tyrosine (Tyr, Y)
n = 6 (2.53%)
Tryptophan (Trp, W)
n = 3 (1.27%)
Aspartic acid (Asp, D)
n = 1 (0.42%)
Glutamic acid (Glu, E)
n = 5 (2.11%)
Asparagine (Asn, N)
n = 6 (2.53%)
Glutamine (Gln, Q)
n = 9 (3.8%)
Histidine (His, H)
n = 5 (2.11%)
Lysine (Lys, K)
n = 5 (2.11%)
Arginine (Arg, R)
n = 4 (1.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 9 13 11 4 15 1 18 8 1 3 4 3 0 7 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 7 6 5 2 1 3 4 1 5 1 13 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 7 1 3 3 1 1 3 1 4 2 0 1 4 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 5 0 0 1 5 0 1 1 2 0 1 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 68 78 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 69 37 110
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 48 103 78
ATP8 (size: 168 bases)
Amino acid sequence: MPQLEPAPWFSMFTVSWLIILLLIMPTIMFYQTQNTVSAQQATKPKQPTWTWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 4 (7.27%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 1 (1.82%)
Glutamine (Gln, Q)
n = 6 (10.91%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 2 1 0 2 0 2 6 0 0 1 0 1 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 2 0 0 0 0 0 0 3 0 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 2 0 1 0 0 0 0 1 0 0 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 1 0 0 2 0 0 0 0 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 17 18 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 20 13 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 8 27 16
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 44 (8.51%)
Alanine (Ala, A)
n = 45 (8.7%)
Serine (Ser, S)
n = 29 (5.61%)
Threonine (Thr, T)
n = 40 (7.74%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.54%)
Leucine (Leu, L)
n = 63 (12.19%)
Isoleucine (Ile, I)
n = 39 (7.54%)
Methionine (Met, M)
n = 26 (5.03%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 41 (7.93%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 17 (3.29%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 11 (2.13%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 11 23 15 5 21 1 20 7 0 14 10 12 3 21 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 17 16 11 1 7 7 26 4 8 3 16 1 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 20 0 8 5 11 0 2 3 13 6 0 1 10 7 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 1 9 6 9 2 4 1 3 0 1 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 104 139 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 137 97 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 117 205 179
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.41%)
Alanine (Ala, A)
n = 13 (5.73%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 18 (7.93%)
Leucine (Leu, L)
n = 25 (11.01%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 7 (3.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 6 8 6 2 12 0 4 8 1 8 2 8 0 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 4 2 7 0 2 2 3 3 3 0 10 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 6 0 4 5 4 0 2 2 5 4 0 1 3 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 14 0 5 6 2 1 0 4 3 0 1 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 58 61 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 55 60 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 51 95 74
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.28%)
Alanine (Ala, A)
n = 23 (8.81%)
Serine (Ser, S)
n = 16 (6.13%)
Threonine (Thr, T)
n = 23 (8.81%)
Cysteine (Cys, C)
n = 3 (1.15%)
Valine (Val, V)
n = 16 (6.13%)
Leucine (Leu, L)
n = 35 (13.41%)
Isoleucine (Ile, I)
n = 11 (4.21%)
Methionine (Met, M)
n = 12 (4.6%)
Proline (Pro, P)
n = 11 (4.21%)
Phenylalanine (Phe, F)
n = 20 (7.66%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 4 (1.53%)
Glutamic acid (Glu, E)
n = 9 (3.45%)
Asparagine (Asn, N)
n = 4 (1.53%)
Glutamine (Gln, Q)
n = 7 (2.68%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 3 10 4 6 13 2 10 7 0 6 3 7 0 9 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 6 10 6 1 6 8 5 0 2 2 7 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 8 2 4 4 4 0 0 4 8 4 0 0 2 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 0 1 3 2 1 0 1 3 1 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 64 57 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 69 56 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 77 104 72
CYTB (size: 1191 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (6.82%)
Alanine (Ala, A)
n = 31 (7.83%)
Serine (Ser, S)
n = 23 (5.81%)
Threonine (Thr, T)
n = 22 (5.56%)
Cysteine (Cys, C)
n = 3 (0.76%)
Valine (Val, V)
n = 18 (4.55%)
Leucine (Leu, L)
n = 54 (13.64%)
Isoleucine (Ile, I)
n = 42 (10.61%)
Methionine (Met, M)
n = 18 (4.55%)
Proline (Pro, P)
n = 22 (5.56%)
Phenylalanine (Phe, F)
n = 31 (7.83%)
Tyrosine (Tyr, Y)
n = 15 (3.79%)
Tryptophan (Trp, W)
n = 11 (2.78%)
Aspartic acid (Asp, D)
n = 9 (2.27%)
Glutamic acid (Glu, E)
n = 7 (1.77%)
Asparagine (Asn, N)
n = 21 (5.3%)
Glutamine (Gln, Q)
n = 8 (2.02%)
Histidine (His, H)
n = 13 (3.28%)
Lysine (Lys, K)
n = 9 (2.27%)
Arginine (Arg, R)
n = 12 (3.03%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 11 13 10 5 18 2 19 7 1 7 2 8 1 17 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 1 10 10 11 0 5 6 12 4 6 4 11 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 8 0 8 4 8 0 1 2 8 7 0 0 12 9 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 2 7 2 7 2 2 1 7 2 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
92 90 116 99
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 95 82 163
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 88 146 143
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.92%)
Alanine (Ala, A)
n = 30 (9.35%)
Serine (Ser, S)
n = 24 (7.48%)
Threonine (Thr, T)
n = 18 (5.61%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 18 (5.61%)
Leucine (Leu, L)
n = 59 (18.38%)
Isoleucine (Ile, I)
n = 26 (8.1%)
Methionine (Met, M)
n = 18 (5.61%)
Proline (Pro, P)
n = 19 (5.92%)
Phenylalanine (Phe, F)
n = 22 (6.85%)
Tyrosine (Tyr, Y)
n = 9 (2.8%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 10 (3.12%)
Asparagine (Asn, N)
n = 13 (4.05%)
Glutamine (Gln, Q)
n = 8 (2.49%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.18%)
Arginine (Arg, R)
n = 7 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 9 16 15 6 11 1 25 8 0 8 2 7 1 13 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 10 7 13 0 3 5 9 2 5 5 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 3 1 5 6 9 0 1 3 6 3 0 1 10 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 3 2 1 7 0 1 0 6 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 69 86 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 87 53 143
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 69 139 103
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.2%)
Alanine (Ala, A)
n = 29 (8.38%)
Serine (Ser, S)
n = 25 (7.23%)
Threonine (Thr, T)
n = 36 (10.4%)
Cysteine (Cys, C)
n = 4 (1.16%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 63 (18.21%)
Isoleucine (Ile, I)
n = 35 (10.12%)
Methionine (Met, M)
n = 22 (6.36%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 19 (5.49%)
Glutamine (Gln, Q)
n = 12 (3.47%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 5 19 18 7 23 1 14 11 1 2 0 5 0 10 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 1 8 10 11 0 2 10 6 0 6 1 11 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 19 0 3 2 12 0 2 6 3 3 0 0 15 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 0 2 1 10 0 2 0 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 91 130 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 101 61 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 66 157 118
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.2%)
Alanine (Ala, A)
n = 29 (8.38%)
Serine (Ser, S)
n = 25 (7.23%)
Threonine (Thr, T)
n = 36 (10.4%)
Cysteine (Cys, C)
n = 4 (1.16%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 63 (18.21%)
Isoleucine (Ile, I)
n = 35 (10.12%)
Methionine (Met, M)
n = 22 (6.36%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 19 (5.49%)
Glutamine (Gln, Q)
n = 12 (3.47%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 5 19 18 7 23 1 14 11 1 2 0 5 0 10 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 1 8 10 11 0 2 10 6 0 6 1 11 1 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 19 0 3 2 12 0 2 6 3 3 0 0 15 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 0 2 1 10 0 2 0 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 91 130 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 101 61 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 66 157 118
ND4 (size: 1377 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (3.28%)
Alanine (Ala, A)
n = 36 (7.86%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 80 (17.47%)
Isoleucine (Ile, I)
n = 48 (10.48%)
Methionine (Met, M)
n = 36 (7.86%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 26 (5.68%)
Tyrosine (Tyr, Y)
n = 8 (1.75%)
Tryptophan (Trp, W)
n = 14 (3.06%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 19 (4.15%)
Glutamine (Gln, Q)
n = 9 (1.97%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 17 33 18 8 33 0 21 9 0 5 2 5 1 14 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 2 14 11 10 1 3 6 6 0 6 5 12 1 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 11 1 9 3 17 0 2 7 7 1 1 0 9 10 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 4 1 4 12 0 2 2 4 1 1 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 114 163 103
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 127 76 203
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 108 193 145
ND4L (size: 291 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.13%)
Alanine (Ala, A)
n = 11 (11.46%)
Serine (Ser, S)
n = 8 (8.33%)
Threonine (Thr, T)
n = 8 (8.33%)
Cysteine (Cys, C)
n = 2 (2.08%)
Valine (Val, V)
n = 2 (2.08%)
Leucine (Leu, L)
n = 26 (27.08%)
Isoleucine (Ile, I)
n = 4 (4.17%)
Methionine (Met, M)
n = 6 (6.25%)
Proline (Pro, P)
n = 5 (5.21%)
Phenylalanine (Phe, F)
n = 4 (4.17%)
Tyrosine (Tyr, Y)
n = 1 (1.04%)
Tryptophan (Trp, W)
n = 1 (1.04%)
Aspartic acid (Asp, D)
n = 1 (1.04%)
Glutamic acid (Glu, E)
n = 2 (2.08%)
Asparagine (Asn, N)
n = 4 (4.17%)
Glutamine (Gln, Q)
n = 2 (2.08%)
Histidine (His, H)
n = 2 (2.08%)
Lysine (Lys, K)
n = 3 (3.13%)
Arginine (Arg, R)
n = 1 (1.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 6 5 1 10 1 9 2 0 0 0 1 1 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 1 0 4 7 0 1 2 0 0 1 3 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 1 3 3 0 1 0 1 0 0 0 3 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 1 3 0 0 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 27 26 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 31 16 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 21 52 22
ND5 (size: 1797 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (4.01%)
Alanine (Ala, A)
n = 47 (7.86%)
Serine (Ser, S)
n = 48 (8.03%)
Threonine (Thr, T)
n = 58 (9.7%)
Cysteine (Cys, C)
n = 8 (1.34%)
Valine (Val, V)
n = 16 (2.68%)
Leucine (Leu, L)
n = 93 (15.55%)
Isoleucine (Ile, I)
n = 57 (9.53%)
Methionine (Met, M)
n = 37 (6.19%)
Proline (Pro, P)
n = 28 (4.68%)
Phenylalanine (Phe, F)
n = 34 (5.69%)
Tyrosine (Tyr, Y)
n = 13 (2.17%)
Tryptophan (Trp, W)
n = 14 (2.34%)
Aspartic acid (Asp, D)
n = 9 (1.51%)
Glutamic acid (Glu, E)
n = 15 (2.51%)
Asparagine (Asn, N)
n = 30 (5.02%)
Glutamine (Gln, Q)
n = 18 (3.01%)
Histidine (His, H)
n = 12 (2.01%)
Lysine (Lys, K)
n = 26 (4.35%)
Arginine (Arg, R)
n = 11 (1.84%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
42 15 35 21 9 40 2 20 18 0 4 5 7 0 20 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 3 5 13 20 11 3 1 6 13 4 9 6 12 1 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 23 2 7 12 13 1 4 11 6 7 2 1 18 12 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 14 1 5 4 25 1 2 2 7 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
111 141 224 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 166 123 237
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 150 251 178
ND6 (size: 495 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (10.37%)
Alanine (Ala, A)
n = 12 (7.32%)
Serine (Ser, S)
n = 17 (10.37%)
Threonine (Thr, T)
n = 4 (2.44%)
Cysteine (Cys, C)
n = 7 (4.27%)
Valine (Val, V)
n = 23 (14.02%)
Leucine (Leu, L)
n = 24 (14.63%)
Isoleucine (Ile, I)
n = 6 (3.66%)
Methionine (Met, M)
n = 7 (4.27%)
Proline (Pro, P)
n = 4 (2.44%)
Phenylalanine (Phe, F)
n = 20 (12.2%)
Tyrosine (Tyr, Y)
n = 9 (5.49%)
Tryptophan (Trp, W)
n = 3 (1.83%)
Aspartic acid (Asp, D)
n = 2 (1.22%)
Glutamic acid (Glu, E)
n = 4 (2.44%)
Asparagine (Asn, N)
n = 3 (1.83%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.61%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (0.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 0 2 3 0 0 0 14 0 0 8 2 5 8 18 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 6 1 8 1 3 0 3 1 4 9 3 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 2 5 2 2 1 6 1 6 3 2 7 3 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 2 0 0 0 0 0 1 0 1 0 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 9 28 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 30 19 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 14 34 80
Total protein-coding genes (size: 11416 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 210 (5.52%)
Alanine (Ala, A)
n = 308 (8.1%)
Serine (Ser, S)
n = 270 (7.1%)
Threonine (Thr, T)
n = 298 (7.83%)
Cysteine (Cys, C)
n = 38 (1.0%)
Valine (Val, V)
n = 184 (4.84%)
Leucine (Leu, L)
n = 604 (15.88%)
Isoleucine (Ile, I)
n = 330 (8.68%)
Methionine (Met, M)
n = 213 (5.6%)
Proline (Pro, P)
n = 207 (5.44%)
Phenylalanine (Phe, F)
n = 244 (6.41%)
Tyrosine (Tyr, Y)
n = 110 (2.89%)
Tryptophan (Trp, W)
n = 108 (2.84%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 96 (2.52%)
Asparagine (Asn, N)
n = 144 (3.79%)
Glutamine (Gln, Q)
n = 97 (2.55%)
Histidine (His, H)
n = 101 (2.66%)
Lysine (Lys, K)
n = 93 (2.44%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
240 90 182 136 55 207 11 182 93 4 66 33 68 17 142 102
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
31 22 16 102 100 98 8 35 58 89 28 57 32 113 5 103
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
71 115 9 64 52 86 3 25 40 68 42 6 13 89 55 47
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
54 81 15 37 30 86 7 14 13 40 4 7 0 4 1 102
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
865 885 1150 905
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
499 1018 713 1575
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
162 843 1553 1247

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.