Viewing data for Dorosoma petenense


Scientific name Dorosoma petenense
Common name Threadfin shad
Maximum lifespan 4.00 years (Dorosoma petenense@AnAge)

Total mtDNA (size: 16792 bases) GC AT G C A T
Base content (bases) 7607 9185 4731 2876 4336 4849
Base content per 1 kb (bases) 453 547 282 171 258 289
Base content (%) 45.3% 54.7%
Total protein-coding genes (size: 11403 bases) GC AT G C A T
Base content (bases) 5184 6219 3381 1803 3088 3131
Base content per 1 kb (bases) 455 545 297 158 271 275
Base content (%) 45.5% 54.5%
D-loop (size: 1133 bases) GC AT G C A T
Base content (bases) 376 757 218 158 361 396
Base content per 1 kb (bases) 332 668 192 139 319 350
Base content (%) 33.2% 66.8%
Total tRNA-coding genes (size: 1553 bases) GC AT G C A T
Base content (bases) 736 817 410 326 361 456
Base content per 1 kb (bases) 474 526 264 210 232 294
Base content (%) 47.4% 52.6%
Total rRNA-coding genes (size: 2633 bases) GC AT G C A T
Base content (bases) 1273 1360 700 573 513 847
Base content per 1 kb (bases) 483 517 266 218 195 322
Base content (%) 48.3% 51.7%
12S rRNA gene (size: 951 bases) GC AT G C A T
Base content (bases) 477 474 261 216 189 285
Base content per 1 kb (bases) 502 498 274 227 199 300
Base content (%) 50.2% 49.8%
16S rRNA gene (size: 1682 bases) GC AT G C A T
Base content (bases) 796 886 439 357 324 562
Base content per 1 kb (bases) 473 527 261 212 193 334
Base content (%) 47.3% 52.7%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 313 370 216 97 196 174
Base content per 1 kb (bases) 458 542 316 142 287 255
Base content (%) 45.8% 54.2%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 70 98 48 22 47 51
Base content per 1 kb (bases) 417 583 286 131 280 304
Base content (%) 41.7% 58.3%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 721 830 422 299 444 386
Base content per 1 kb (bases) 465 535 272 193 286 249
Base content (%) 46.5% 53.5%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 307 384 190 117 185 199
Base content per 1 kb (bases) 444 556 275 169 268 288
Base content (%) 44.4% 55.6%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 380 405 240 140 216 189
Base content per 1 kb (bases) 484 516 306 178 275 241
Base content (%) 48.4% 51.6%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 505 636 319 186 331 305
Base content per 1 kb (bases) 443 557 280 163 290 267
Base content (%) 44.3% 55.7%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 457 518 304 153 276 242
Base content per 1 kb (bases) 469 531 312 157 283 248
Base content (%) 46.9% 53.1%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 482 563 340 142 267 296
Base content per 1 kb (bases) 461 539 325 136 256 283
Base content (%) 46.1% 53.9%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 152 197 99 53 111 86
Base content per 1 kb (bases) 436 564 284 152 318 246
Base content (%) 43.6% 56.4%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 607 774 389 218 382 392
Base content per 1 kb (bases) 440 560 282 158 277 284
Base content (%) 44.0% 56.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 149 148 97 52 74 74
Base content per 1 kb (bases) 502 498 327 175 249 249
Base content (%) 50.2% 49.8%
ND5 (size: 1836 bases) GC AT G C A T
Base content (bases) 817 1019 560 257 483 536
Base content per 1 kb (bases) 445 555 305 140 263 292
Base content (%) 44.5% 55.5%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 228 294 159 69 83 211
Base content per 1 kb (bases) 437 563 305 132 159 404
Base content (%) 43.7% 56.3%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (5.31%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 7 (3.1%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 16 (7.08%)
Leucine (Leu, L)
n = 55 (24.34%)
Isoleucine (Ile, I)
n = 18 (7.96%)
Methionine (Met, M)
n = 8 (3.54%)
Proline (Pro, P)
n = 17 (7.52%)
Phenylalanine (Phe, F)
n = 10 (4.42%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 9 5 16 6 16 5 10 8 1 5 8 3 0 4 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 2 10 7 0 1 4 6 1 4 8 5 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 9 0 1 1 1 0 0 4 1 3 3 2 4 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 1 0 1 0 0 1 4 1 0 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 78 62 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 61 31 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 77 80 53
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFAILVFSWLIFLTVIPPKVLAHNFNNEPTTVGAEKAKPESWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 2 (3.64%)
Threonine (Thr, T)
n = 3 (5.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (7.27%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 0 2 0 1 0 2 1 0 0 1 3 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 2 1 0 0 1 0 0 4 2 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 1 0 1 1 0 0 0 0 0 1 0 0 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 1 0 0 2 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
13 13 15 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 18 15 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 17 21 15
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.91%)
Alanine (Ala, A)
n = 47 (9.11%)
Serine (Ser, S)
n = 31 (6.01%)
Threonine (Thr, T)
n = 35 (6.78%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 43 (8.33%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 10 7 23 8 18 7 7 7 1 10 6 23 4 17 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
17 0 1 3 24 18 2 4 10 17 15 5 10 10 3 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 12 3 3 11 11 1 0 5 5 13 2 0 9 5 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 7 4 2 12 9 0 1 0 5 2 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
161 119 125 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 136 94 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
61 167 167 122
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 16 (6.99%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 8 (3.49%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 21 (9.17%)
Leucine (Leu, L)
n = 29 (12.66%)
Isoleucine (Ile, I)
n = 19 (8.3%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 7 (3.06%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 14 (6.11%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 7 5 5 7 10 1 5 8 0 4 7 8 2 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 1 2 9 4 1 1 3 3 2 3 5 5 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 0 2 7 5 0 1 2 4 5 0 1 1 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 14 1 3 11 4 0 0 1 5 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 61 51 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 52 64 89
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 77 84 52
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (8.46%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 14 (5.38%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 6 (2.31%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 10 4 10 6 5 5 5 8 0 3 5 7 1 9 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 2 9 9 1 2 7 11 2 1 7 4 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 6 1 5 1 5 0 0 3 4 7 2 2 1 1 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 2 1 4 1 1 0 1 1 3 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 68 52 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 69 53 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 103 83 52
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (7.39%)
Alanine (Ala, A)
n = 31 (8.18%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 22 (5.8%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 28 (7.39%)
Leucine (Leu, L)
n = 58 (15.3%)
Isoleucine (Ile, I)
n = 27 (7.12%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 8 (2.11%)
Asparagine (Asn, N)
n = 19 (5.01%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 10 7 13 10 20 6 9 6 0 7 5 13 3 15 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 1 3 13 14 1 1 6 16 5 3 8 9 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 9 0 4 9 9 0 0 1 4 10 1 0 6 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 3 5 1 9 7 2 2 0 5 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
105 96 89 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 96 78 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 127 138 86
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (6.17%)
Alanine (Ala, A)
n = 33 (10.19%)
Serine (Ser, S)
n = 23 (7.1%)
Threonine (Thr, T)
n = 22 (6.79%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 18 (5.56%)
Leucine (Leu, L)
n = 61 (18.83%)
Isoleucine (Ile, I)
n = 24 (7.41%)
Methionine (Met, M)
n = 10 (3.09%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 20 (6.17%)
Tyrosine (Tyr, Y)
n = 12 (3.7%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 8 (2.47%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 14 8 16 11 15 5 12 5 1 4 6 6 2 10 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 4 15 13 1 2 6 10 2 3 13 6 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 5 3 3 10 6 0 0 4 5 7 1 2 4 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 7 4 1 3 7 0 0 1 6 1 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 89 75 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 98 53 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 117 114 68
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 37 (10.66%)
Serine (Ser, S)
n = 22 (6.34%)
Threonine (Thr, T)
n = 49 (14.12%)
Cysteine (Cys, C)
n = 3 (0.86%)
Valine (Val, V)
n = 15 (4.32%)
Leucine (Leu, L)
n = 67 (19.31%)
Isoleucine (Ile, I)
n = 23 (6.63%)
Methionine (Met, M)
n = 16 (4.61%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 4 (1.15%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 7 (2.02%)
Glutamine (Gln, Q)
n = 13 (3.75%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 8 12 15 17 21 5 9 10 3 3 3 8 1 6 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 6 21 10 0 1 4 7 4 7 6 4 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 20 2 4 7 5 0 0 6 4 4 1 0 4 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 2 2 8 1 0 1 3 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 103 110 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 121 54 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 116 132 76
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 37 (10.66%)
Serine (Ser, S)
n = 22 (6.34%)
Threonine (Thr, T)
n = 49 (14.12%)
Cysteine (Cys, C)
n = 3 (0.86%)
Valine (Val, V)
n = 15 (4.32%)
Leucine (Leu, L)
n = 67 (19.31%)
Isoleucine (Ile, I)
n = 23 (6.63%)
Methionine (Met, M)
n = 16 (4.61%)
Proline (Pro, P)
n = 19 (5.48%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 4 (1.15%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 7 (2.02%)
Glutamine (Gln, Q)
n = 13 (3.75%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 9 (2.59%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 8 12 15 17 21 5 9 10 3 3 3 8 1 6 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 6 21 10 0 1 4 7 4 7 6 4 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 20 2 4 7 5 0 0 6 4 4 1 0 4 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 2 2 8 1 0 1 3 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 103 110 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 121 54 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 116 132 76
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (6.32%)
Alanine (Ala, A)
n = 38 (8.28%)
Serine (Ser, S)
n = 25 (5.45%)
Threonine (Thr, T)
n = 47 (10.24%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 19 (4.14%)
Leucine (Leu, L)
n = 85 (18.52%)
Isoleucine (Ile, I)
n = 39 (8.5%)
Methionine (Met, M)
n = 25 (5.45%)
Proline (Pro, P)
n = 27 (5.88%)
Phenylalanine (Phe, F)
n = 18 (3.92%)
Tyrosine (Tyr, Y)
n = 13 (2.83%)
Tryptophan (Trp, W)
n = 21 (4.58%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 11 (2.4%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 15 19 14 15 28 5 19 6 4 3 4 9 3 15 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 2 6 18 12 2 2 6 15 6 7 10 8 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 17 0 4 8 5 0 1 7 5 8 5 4 2 9 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 9 3 0 4 10 0 1 1 8 2 0 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
102 122 140 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 129 71 186
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 138 181 99
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 11 (11.22%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 4 (4.08%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 4 (4.08%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 1 7 2 9 4 1 3 1 0 0 4 0 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 2 6 4 1 1 1 3 0 0 1 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 4 2 1 3 1 0 1 2 0 0 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 0 0 1 0 0 0 0 3 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
26 34 21 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 31 14 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 32 39 17
ND5 (size: 1836 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.4%)
Alanine (Ala, A)
n = 60 (9.82%)
Serine (Ser, S)
n = 40 (6.55%)
Threonine (Thr, T)
n = 65 (10.64%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 29 (4.75%)
Leucine (Leu, L)
n = 87 (14.24%)
Isoleucine (Ile, I)
n = 53 (8.67%)
Methionine (Met, M)
n = 29 (4.75%)
Proline (Pro, P)
n = 30 (4.91%)
Phenylalanine (Phe, F)
n = 39 (6.38%)
Tyrosine (Tyr, Y)
n = 12 (1.96%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 17 (2.78%)
Glutamic acid (Glu, E)
n = 10 (1.64%)
Asparagine (Asn, N)
n = 24 (3.93%)
Glutamine (Gln, Q)
n = 19 (3.11%)
Histidine (His, H)
n = 14 (2.29%)
Lysine (Lys, K)
n = 20 (3.27%)
Arginine (Arg, R)
n = 10 (1.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 22 14 15 17 32 6 14 19 0 6 9 13 1 17 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
15 0 6 7 32 19 2 5 11 15 2 7 12 11 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
33 20 1 6 10 14 0 3 7 6 6 2 3 4 20 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 2 2 15 19 1 1 2 7 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 143 201 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 185 117 237
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 232 218 127
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (12.14%)
Alanine (Ala, A)
n = 18 (10.4%)
Serine (Ser, S)
n = 16 (9.25%)
Threonine (Thr, T)
n = 6 (3.47%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 22 (12.72%)
Leucine (Leu, L)
n = 26 (15.03%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 10 (5.78%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 18 (10.4%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 2 (1.16%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 5 (2.89%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 3 5 0 2 1 9 0 0 10 0 5 7 17 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 1 6 3 6 3 3 1 5 12 1 0 1 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 2 6 0 2 4 2 2 7 0 2 9 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 4 3 0 0 1 0 0 3 1 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 18 26 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 41 19 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
56 10 38 70
Total protein-coding genes (size: 11424 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 246 (6.47%)
Alanine (Ala, A)
n = 349 (9.17%)
Serine (Ser, S)
n = 240 (6.31%)
Threonine (Thr, T)
n = 318 (8.36%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 239 (6.28%)
Leucine (Leu, L)
n = 617 (16.22%)
Isoleucine (Ile, I)
n = 275 (7.23%)
Methionine (Met, M)
n = 161 (4.23%)
Proline (Pro, P)
n = 216 (5.68%)
Phenylalanine (Phe, F)
n = 239 (6.28%)
Tyrosine (Tyr, Y)
n = 111 (2.92%)
Tryptophan (Trp, W)
n = 118 (3.1%)
Aspartic acid (Asp, D)
n = 80 (2.1%)
Glutamic acid (Glu, E)
n = 102 (2.68%)
Asparagine (Asn, N)
n = 107 (2.81%)
Glutamine (Gln, Q)
n = 95 (2.5%)
Histidine (His, H)
n = 102 (2.68%)
Lysine (Lys, K)
n = 76 (2.0%)
Arginine (Arg, R)
n = 78 (2.05%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
163 112 88 147 104 185 50 108 83 12 55 54 106 24 125 114
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
73 10 20 46 168 121 14 23 60 111 52 46 86 68 16 57
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
139 108 14 42 72 66 6 9 45 45 66 21 23 38 69 36
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
66 74 28 16 64 69 7 6 8 51 13 0 0 6 0 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1016 977 991 821
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
526 1069 679 1531
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
353 1247 1341 864

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.