Viewing data for Carduelis psaltria


Scientific name Carduelis psaltria
Common name Lesser goldfinch
Maximum lifespan 5.70 years (Carduelis psaltria@AnAge)

Total mtDNA (size: 16812 bases) GC AT G C A T
Base content (bases) 7515 9297 5200 2315 4076 5221
Base content per 1 kb (bases) 447 553 309 138 242 311
Base content (%) 44.7% 55.3%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5174 6204 3803 1371 2757 3447
Base content per 1 kb (bases) 455 545 334 120 242 303
Base content (%) 45.5% 54.5%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1539 bases) GC AT G C A T
Base content (bases) 626 913 365 261 398 515
Base content per 1 kb (bases) 407 593 237 170 259 335
Base content (%) 40.7% 59.3%
Total rRNA-coding genes (size: 2572 bases) GC AT G C A T
Base content (bases) 1162 1410 642 520 552 858
Base content per 1 kb (bases) 452 548 250 202 215 334
Base content (%) 45.2% 54.8%
12S rRNA gene (size: 974 bases) GC AT G C A T
Base content (bases) 466 508 263 203 203 305
Base content per 1 kb (bases) 478 522 270 208 208 313
Base content (%) 47.8% 52.2%
16S rRNA gene (size: 1598 bases) GC AT G C A T
Base content (bases) 696 902 379 317 349 553
Base content per 1 kb (bases) 436 564 237 198 218 346
Base content (%) 43.6% 56.4%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 301 383 239 62 172 211
Base content per 1 kb (bases) 440 560 349 91 251 308
Base content (%) 44.0% 56.0%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 70 98 59 11 45 53
Base content per 1 kb (bases) 417 583 351 65 268 315
Base content (%) 41.7% 58.3%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 717 834 473 244 394 440
Base content per 1 kb (bases) 462 538 305 157 254 284
Base content (%) 46.2% 53.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 312 372 212 100 159 213
Base content per 1 kb (bases) 456 544 310 146 232 311
Base content (%) 45.6% 54.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 371 413 252 119 194 219
Base content per 1 kb (bases) 473 527 321 152 247 279
Base content (%) 47.3% 52.7%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 532 611 386 146 283 328
Base content per 1 kb (bases) 465 535 338 128 248 287
Base content (%) 46.5% 53.5%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 429 549 302 127 269 280
Base content per 1 kb (bases) 439 561 309 130 275 286
Base content (%) 43.9% 56.1%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 437 603 344 93 271 332
Base content per 1 kb (bases) 420 580 331 89 261 319
Base content (%) 42.0% 58.0%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 161 190 119 42 91 99
Base content per 1 kb (bases) 459 541 339 120 259 282
Base content (%) 45.9% 54.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 629 749 486 143 321 428
Base content per 1 kb (bases) 456 544 353 104 233 311
Base content (%) 45.6% 54.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 146 151 110 36 70 81
Base content per 1 kb (bases) 492 508 370 121 236 273
Base content (%) 49.2% 50.8%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 824 994 619 205 433 561
Base content per 1 kb (bases) 453 547 340 113 238 309
Base content (%) 45.3% 54.7%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 250 269 205 45 59 210
Base content per 1 kb (bases) 482 518 395 87 114 405
Base content (%) 48.2% 51.8%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 14 (6.17%)
Serine (Ser, S)
n = 14 (6.17%)
Threonine (Thr, T)
n = 25 (11.01%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 10 8 6 12 35 4 4 8 0 1 2 5 0 1 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 9 3 0 3 3 2 0 0 6 9 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 12 0 1 6 4 0 0 3 1 2 0 0 0 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 3 4 0 0 2 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 88 69 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 65 36 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 86 106 31
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFFIMIISWITFSLIIQPKILTFVTMNPPSNKPPIAPSTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 3 (5.45%)
Isoleucine (Ile, I)
n = 8 (14.55%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 11 (20.0%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 4 1 1 1 1 0 0 2 0 0 0 1 0 4 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 1 0 0 0 0 0 1 6 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 0 2 1 0 0 1 0 0 0 0 2 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 16 24 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 23 8 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 20 21 13
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 38 (7.36%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.75%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 22 (4.26%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 28 20 9 12 36 1 5 9 0 7 12 19 2 8 35
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 6 20 19 0 10 10 26 1 6 9 15 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 15 2 3 9 12 0 0 4 1 16 0 0 2 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 10 0 2 13 9 0 1 2 5 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
157 124 129 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 137 94 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 212 217 79
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 18 (7.93%)
Leucine (Leu, L)
n = 29 (12.78%)
Isoleucine (Ile, I)
n = 13 (5.73%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 10 13 5 8 9 3 4 6 0 4 4 10 0 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 4 6 6 1 1 1 6 0 4 3 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 7 1 5 5 6 0 0 5 1 6 0 0 0 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 0 2 11 4 0 0 3 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 59 58 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 61 58 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 92 97 33
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 25 (9.62%)
Serine (Ser, S)
n = 17 (6.54%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 14 (5.38%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 13 6 4 3 20 1 5 6 2 6 4 5 0 2 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 6 12 7 0 1 6 11 1 2 4 7 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 10 0 4 4 4 0 0 5 2 9 0 0 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 0 1 3 4 0 0 1 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 71 55 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 71 55 93
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 110 109 36
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 28 (7.37%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 25 (6.58%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 25 (6.58%)
Leucine (Leu, L)
n = 63 (16.58%)
Isoleucine (Ile, I)
n = 34 (8.95%)
Methionine (Met, M)
n = 7 (1.84%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 27 (7.11%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 24 6 4 18 36 2 3 8 0 6 7 12 0 1 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 7 13 8 0 2 10 11 1 4 7 13 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 14 0 2 9 9 1 0 1 1 11 0 0 3 18 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 0 0 8 9 1 2 3 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
92 112 98 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 98 79 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 176 151 48
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 31 (9.54%)
Serine (Ser, S)
n = 24 (7.38%)
Threonine (Thr, T)
n = 19 (5.85%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 15 (4.62%)
Leucine (Leu, L)
n = 67 (20.62%)
Isoleucine (Ile, I)
n = 24 (7.38%)
Methionine (Met, M)
n = 10 (3.08%)
Proline (Pro, P)
n = 25 (7.69%)
Phenylalanine (Phe, F)
n = 17 (5.23%)
Tyrosine (Tyr, Y)
n = 15 (4.62%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 14 (4.31%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 3 (0.92%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 9 6 7 14 33 4 9 6 0 2 3 8 2 7 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 5 9 16 1 2 6 4 2 3 9 13 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 6 0 5 7 7 0 2 3 7 8 0 0 1 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 2 2 7 0 2 1 5 0 1 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 100 80 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 94 60 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 108 140 65
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 24 (6.96%)
Serine (Ser, S)
n = 33 (9.57%)
Threonine (Thr, T)
n = 43 (12.46%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 36 (10.43%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 18 14 8 17 34 2 5 9 1 2 4 3 1 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 6 9 9 0 3 4 6 0 7 4 9 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 15 0 4 11 13 0 1 4 1 6 1 0 2 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 1 14 0 1 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 104 126 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 115 58 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 125 147 67
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 24 (6.96%)
Serine (Ser, S)
n = 33 (9.57%)
Threonine (Thr, T)
n = 43 (12.46%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 36 (10.43%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 18 14 8 17 34 2 5 9 1 2 4 3 1 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 6 9 9 0 3 4 6 0 7 4 9 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 15 0 4 11 13 0 1 4 1 6 1 0 2 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 1 14 0 1 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 104 126 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 115 58 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 125 147 67
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 41 (8.95%)
Serine (Ser, S)
n = 36 (7.86%)
Threonine (Thr, T)
n = 40 (8.73%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 98 (21.4%)
Isoleucine (Ile, I)
n = 47 (10.26%)
Methionine (Met, M)
n = 25 (5.46%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 12 (2.62%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 15 (3.28%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 39 23 15 26 47 3 7 14 0 2 3 5 0 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 6 20 13 2 2 6 8 1 3 12 12 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 18 1 6 8 11 1 0 10 2 11 0 0 2 14 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 10 0 1 1 10 0 1 0 10 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 158 148 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 134 80 192
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 194 200 55
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 5 6 2 4 12 1 0 3 0 1 0 0 1 0 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 2 5 2 0 1 2 1 0 0 1 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 0 5 4 0 0 4 0 3 0 0 0 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 1 1 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 33 26 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 48 37 10
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 49 (8.1%)
Serine (Ser, S)
n = 52 (8.6%)
Threonine (Thr, T)
n = 62 (10.25%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 19 (3.14%)
Leucine (Leu, L)
n = 102 (16.86%)
Isoleucine (Ile, I)
n = 55 (9.09%)
Methionine (Met, M)
n = 31 (5.12%)
Proline (Pro, P)
n = 31 (5.12%)
Phenylalanine (Phe, F)
n = 36 (5.95%)
Tyrosine (Tyr, Y)
n = 11 (1.82%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 28 (4.63%)
Glutamine (Gln, Q)
n = 16 (2.64%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 46 29 8 24 57 1 12 14 2 3 8 7 1 7 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 5 7 27 15 0 2 10 20 1 8 17 6 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
31 19 2 5 17 20 0 1 9 0 11 0 0 6 22 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 2 2 6 18 2 0 2 5 1 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
121 159 207 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 184 109 243
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 276 245 71
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (18.02%)
Alanine (Ala, A)
n = 11 (6.4%)
Serine (Ser, S)
n = 15 (8.72%)
Threonine (Thr, T)
n = 3 (1.74%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 34 (19.77%)
Leucine (Leu, L)
n = 32 (18.6%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 7 (4.07%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 8 (4.65%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 5 (2.91%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 2 5 0 1 0 9 0 0 15 0 0 19 8 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 5 0 0 6 9 2 6 14 2 0 0 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 2 6 0 3 1 4 1 7 0 3 17 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 2 2 0 0 0 0 0 0 4 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 14 18 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 28 16 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
76 3 25 69
Total protein-coding genes (size: 11395 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 223 (5.87%)
Alanine (Ala, A)
n = 303 (7.98%)
Serine (Ser, S)
n = 287 (7.56%)
Threonine (Thr, T)
n = 314 (8.27%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 199 (5.24%)
Leucine (Leu, L)
n = 666 (17.54%)
Isoleucine (Ile, I)
n = 304 (8.01%)
Methionine (Met, M)
n = 163 (4.29%)
Proline (Pro, P)
n = 224 (5.9%)
Phenylalanine (Phe, F)
n = 215 (5.66%)
Tyrosine (Tyr, Y)
n = 108 (2.85%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 64 (1.69%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 136 (3.58%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 106 (2.79%)
Lysine (Lys, K)
n = 85 (2.24%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
91 213 139 77 146 338 24 64 88 5 49 48 76 26 50 165
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
24 5 23 57 135 101 10 36 62 103 22 41 81 99 3 54
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
131 121 8 42 86 97 3 8 51 23 85 4 17 19 117 17
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
89 86 6 13 51 82 3 7 15 44 5 2 1 6 1 102
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
881 1079 1064 773
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
490 1069 691 1547
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
162 1498 1548 589

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.