Viewing data for Vulpes vulpes


Scientific name Vulpes vulpes
Common name Red fox
Maximum lifespan 21.30 years (Vulpes vulpes@AnAge)

Total mtDNA (size: 16813 bases) GC AT G C A T
Base content (bases) 6880 9933 4378 2502 4676 5257
Base content per 1 kb (bases) 409 591 260 149 278 313
Base content (%) 40.9% 59.1%
Total protein-coding genes (size: 11343 bases) GC AT G C A T
Base content (bases) 4688 6655 3128 1560 3258 3397
Base content per 1 kb (bases) 413 587 276 138 287 299
Base content (%) 41.3% 58.7%
D-loop (size: 1354 bases) GC AT G C A T
Base content (bases) 615 739 385 230 347 392
Base content per 1 kb (bases) 454 546 284 170 256 290
Base content (%) 45.4% 54.6%
Total tRNA-coding genes (size: 1510 bases) GC AT G C A T
Base content (bases) 553 957 310 243 436 521
Base content per 1 kb (bases) 366 634 205 161 289 345
Base content (%) 36.6% 63.4%
Total rRNA-coding genes (size: 2535 bases) GC AT G C A T
Base content (bases) 993 1542 537 456 620 922
Base content per 1 kb (bases) 392 608 212 180 245 364
Base content (%) 39.2% 60.8%
12S rRNA gene (size: 957 bases) GC AT G C A T
Base content (bases) 390 567 212 178 226 341
Base content per 1 kb (bases) 408 592 222 186 236 356
Base content (%) 40.8% 59.2%
16S rRNA gene (size: 1578 bases) GC AT G C A T
Base content (bases) 603 975 325 278 394 581
Base content per 1 kb (bases) 382 618 206 176 250 368
Base content (%) 38.2% 61.8%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 284 397 199 85 195 202
Base content per 1 kb (bases) 417 583 292 125 286 297
Base content (%) 41.7% 58.3%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 71 133 51 20 58 75
Base content per 1 kb (bases) 348 652 250 98 284 368
Base content (%) 34.8% 65.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 651 894 379 272 476 418
Base content per 1 kb (bases) 421 579 245 176 308 271
Base content (%) 42.1% 57.9%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 274 410 172 102 190 220
Base content per 1 kb (bases) 401 599 251 149 278 322
Base content (%) 40.1% 59.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 355 429 228 127 225 204
Base content per 1 kb (bases) 453 547 291 162 287 260
Base content (%) 45.3% 54.7%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 482 658 316 166 335 323
Base content per 1 kb (bases) 423 577 277 146 294 283
Base content (%) 42.3% 57.7%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 419 538 292 127 276 262
Base content per 1 kb (bases) 438 562 305 133 288 274
Base content (%) 43.8% 56.2%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 408 636 294 114 281 355
Base content per 1 kb (bases) 391 609 282 109 269 340
Base content (%) 39.1% 60.9%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 136 211 91 45 106 105
Base content per 1 kb (bases) 392 608 262 130 305 303
Base content (%) 39.2% 60.8%
ND4 (size: 1379 bases) GC AT G C A T
Base content (bases) 567 812 394 173 395 417
Base content per 1 kb (bases) 411 589 286 125 286 302
Base content (%) 41.1% 58.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 116 181 72 44 93 88
Base content per 1 kb (bases) 391 609 242 148 313 296
Base content (%) 39.1% 60.9%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 747 1074 512 235 530 544
Base content per 1 kb (bases) 410 590 281 129 291 299
Base content (%) 41.0% 59.0%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 201 327 144 57 119 208
Base content per 1 kb (bases) 381 619 273 108 225 394
Base content (%) 38.1% 61.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 23 (10.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 8 7 5 5 17 4 10 6 3 1 3 5 0 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 5 10 4 0 0 2 6 3 3 7 3 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 0 5 1 3 1 3 0 0 2 0 2 5 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 1 0 1 3 1 0 1 4 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 65 79 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 65 38 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 69 85 53
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWLVMILSMILTLFILFQLKVSKHYYPESPGPKSIKSISKHTPWENKWTKIYSPLSLPLQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.49%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 9 (13.43%)
Threonine (Thr, T)
n = 5 (7.46%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (2.99%)
Leucine (Leu, L)
n = 10 (14.93%)
Isoleucine (Ile, I)
n = 6 (8.96%)
Methionine (Met, M)
n = 3 (4.48%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 2 (2.99%)
Tyrosine (Tyr, Y)
n = 3 (4.48%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 1 (1.49%)
Glutamine (Gln, Q)
n = 3 (4.48%)
Histidine (His, H)
n = 2 (2.99%)
Lysine (Lys, K)
n = 7 (10.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 2 2 0 5 1 2 2 1 1 0 1 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 1 0 3 1 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 1 2 0 3 2 0 2 2 1 0 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 0 1 6 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 20 24 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 19 20 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 12 31 17
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 41 (7.98%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (7.0%)
Leucine (Leu, L)
n = 58 (11.28%)
Isoleucine (Ile, I)
n = 39 (7.59%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 18 26 8 4 20 6 17 6 1 7 8 17 4 15 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 16 10 13 2 11 9 17 10 11 9 7 1 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 5 9 6 11 1 1 2 7 12 1 3 7 10 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 3 6 9 8 1 2 0 4 2 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 99 140 127
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 96 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 145 182 141
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 5 12 5 4 12 3 8 6 1 5 5 5 0 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 2 3 0 4 0 3 4 1 4 0 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 5 0 4 4 5 0 1 3 2 9 0 1 2 4 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 4 4 6 3 1 0 0 6 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 57 67 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 61 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 61 92 55
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 9 8 5 4 17 4 1 7 0 3 8 5 1 10 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 6 7 1 0 2 6 9 4 2 3 4 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 1 6 7 4 1 0 3 8 5 2 0 4 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 1 1 2 1 1 0 1 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 70 60 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 57 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 92 87 61
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 55 (14.51%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 13 (3.43%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 22 8 10 9 21 2 11 4 2 5 3 7 2 12 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 4 5 7 14 1 2 5 13 5 3 9 8 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 10 0 6 5 12 0 1 2 8 6 1 2 6 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 0 2 11 8 1 1 1 5 1 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 91 108 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 97 76 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 128 139 88
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 29 (9.12%)
Serine (Ser, S)
n = 22 (6.92%)
Threonine (Thr, T)
n = 20 (6.29%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 13 (4.09%)
Leucine (Leu, L)
n = 57 (17.92%)
Isoleucine (Ile, I)
n = 31 (9.75%)
Methionine (Met, M)
n = 17 (5.35%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 22 (6.92%)
Tyrosine (Tyr, Y)
n = 11 (3.46%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 13 (4.09%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 16 13 7 16 23 3 6 6 0 1 5 5 2 8 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 4 16 8 1 2 2 5 3 5 9 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 10 0 4 6 8 2 0 2 5 6 1 2 6 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 7 4 1 2 5 2 1 1 3 3 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 89 90 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 91 56 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 112 116 64
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 23 (6.63%)
Serine (Ser, S)
n = 31 (8.93%)
Threonine (Thr, T)
n = 34 (9.8%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.17%)
Leucine (Leu, L)
n = 54 (15.56%)
Isoleucine (Ile, I)
n = 36 (10.37%)
Methionine (Met, M)
n = 39 (11.24%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 15 (4.32%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 19 36 5 11 26 8 3 6 3 2 6 2 1 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 7 13 2 3 4 7 1 7 5 8 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 14 0 3 12 11 2 1 2 2 7 1 1 6 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 1 2 13 2 0 0 3 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 87 140 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 105 60 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 102 155 65
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 23 (6.63%)
Serine (Ser, S)
n = 31 (8.93%)
Threonine (Thr, T)
n = 34 (9.8%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.17%)
Leucine (Leu, L)
n = 54 (15.56%)
Isoleucine (Ile, I)
n = 36 (10.37%)
Methionine (Met, M)
n = 39 (11.24%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 12 (3.46%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 15 (4.32%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 19 36 5 11 26 8 3 6 3 2 6 2 1 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 7 13 2 3 4 7 1 7 5 8 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 14 0 3 12 11 2 1 2 2 7 1 1 6 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 1 2 13 2 0 0 3 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 87 140 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 105 60 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 102 155 65
ND4 (size: 1379 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 35 (7.64%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 14 (3.06%)
Leucine (Leu, L)
n = 95 (20.74%)
Isoleucine (Ile, I)
n = 44 (9.61%)
Methionine (Met, M)
n = 32 (6.99%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 21 (4.59%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 18 28 14 13 42 10 10 9 2 3 1 10 0 3 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 1 6 10 13 2 6 4 3 4 5 10 6 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 15 1 7 12 9 1 5 6 6 11 2 6 5 16 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 4 0 5 11 2 2 1 5 2 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 134 156 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 119 85 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 141 176 99
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 9 (9.18%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 8 1 2 10 5 3 2 0 1 1 4 3 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 1 2 3 0 0 2 2 0 0 0 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 3 2 4 0 0 1 1 2 0 1 2 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 25 28 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 20 18 52
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 27 42 17
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.79%)
Alanine (Ala, A)
n = 46 (7.59%)
Serine (Ser, S)
n = 52 (8.58%)
Threonine (Thr, T)
n = 49 (8.09%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 22 (3.63%)
Leucine (Leu, L)
n = 85 (14.03%)
Isoleucine (Ile, I)
n = 55 (9.08%)
Methionine (Met, M)
n = 43 (7.1%)
Proline (Pro, P)
n = 24 (3.96%)
Phenylalanine (Phe, F)
n = 44 (7.26%)
Tyrosine (Tyr, Y)
n = 21 (3.47%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 12 (1.98%)
Glutamic acid (Glu, E)
n = 10 (1.65%)
Asparagine (Asn, N)
n = 27 (4.46%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 18 (2.97%)
Lysine (Lys, K)
n = 24 (3.96%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 25 33 14 21 28 8 10 17 2 6 4 8 4 17 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 1 4 5 21 19 1 4 10 10 5 4 12 8 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 11 3 10 13 14 2 6 7 11 10 2 4 12 15 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 6 4 6 6 21 3 2 2 5 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
119 141 211 136
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 158 132 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 213 201 145
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.57%)
Alanine (Ala, A)
n = 10 (5.71%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 12 (6.86%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 22 (12.57%)
Leucine (Leu, L)
n = 21 (12.0%)
Isoleucine (Ile, I)
n = 15 (8.57%)
Methionine (Met, M)
n = 9 (5.14%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 12 (6.86%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 2 3 0 0 2 3 9 1 0 8 0 6 8 10 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 6 1 1 2 12 1 5 4 2 1 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 1 5 0 1 0 3 2 5 4 3 7 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 6 4 1 1 3 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 10 49 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 31 32 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 16 38 79
Total protein-coding genes (size: 11411 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 266 (7.0%)
Serine (Ser, S)
n = 289 (7.6%)
Threonine (Thr, T)
n = 298 (7.84%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 189 (4.97%)
Leucine (Leu, L)
n = 589 (15.5%)
Isoleucine (Ile, I)
n = 336 (8.84%)
Methionine (Met, M)
n = 251 (6.6%)
Proline (Pro, P)
n = 194 (5.1%)
Phenylalanine (Phe, F)
n = 228 (6.0%)
Tyrosine (Tyr, Y)
n = 135 (3.55%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 75 (1.97%)
Glutamic acid (Glu, E)
n = 94 (2.47%)
Asparagine (Asn, N)
n = 145 (3.81%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 104 (2.74%)
Lysine (Lys, K)
n = 102 (2.68%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
186 150 190 82 93 232 61 92 74 15 44 44 76 25 93 135
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
61 6 18 59 96 96 15 42 50 83 40 51 68 67 8 81
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
99 106 12 65 69 87 13 22 33 59 76 14 29 62 83 29
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
75 65 29 26 49 83 19 10 7 40 8 1 0 8 1 90
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
839 920 1188 855
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
464 992 753 1593
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
350 1145 1390 917

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.