Viewing data for Alopias pelagicus


Scientific name Alopias pelagicus
Common name Pelagic thresher shark
Maximum lifespan 29.00 years (Alopias pelagicus@AnAge)

Total mtDNA (size: 16692 bases) GC AT G C A T
Base content (bases) 6448 10244 4230 2218 4890 5354
Base content per 1 kb (bases) 386 614 253 133 293 321
Base content (%) 38.6% 61.4%
Total protein-coding genes (size: 11402 bases) GC AT G C A T
Base content (bases) 4460 6942 3102 1358 3409 3533
Base content per 1 kb (bases) 391 609 272 119 299 310
Base content (%) 39.1% 60.9%
D-loop (size: 1062 bases) GC AT G C A T
Base content (bases) 360 702 222 138 351 351
Base content per 1 kb (bases) 339 661 209 130 331 331
Base content (%) 33.9% 66.1%
Total tRNA-coding genes (size: 1551 bases) GC AT G C A T
Base content (bases) 600 951 338 262 431 520
Base content per 1 kb (bases) 387 613 218 169 278 335
Base content (%) 38.7% 61.3%
Total rRNA-coding genes (size: 2619 bases) GC AT G C A T
Base content (bases) 1010 1609 557 453 679 930
Base content per 1 kb (bases) 386 614 213 173 259 355
Base content (%) 38.6% 61.4%
12S rRNA gene (size: 951 bases) GC AT G C A T
Base content (bases) 404 547 222 182 228 319
Base content per 1 kb (bases) 425 575 233 191 240 335
Base content (%) 42.5% 57.5%
16S rRNA gene (size: 1668 bases) GC AT G C A T
Base content (bases) 606 1062 335 271 451 611
Base content per 1 kb (bases) 363 637 201 162 270 366
Base content (%) 36.3% 63.7%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 265 419 194 71 208 211
Base content per 1 kb (bases) 387 613 284 104 304 308
Base content (%) 38.7% 61.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 52 116 41 11 50 66
Base content per 1 kb (bases) 310 690 244 65 298 393
Base content (%) 31.0% 69.0%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 594 960 350 244 510 450
Base content per 1 kb (bases) 382 618 225 157 328 290
Base content (%) 38.2% 61.8%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 259 432 161 98 207 225
Base content per 1 kb (bases) 375 625 233 142 300 326
Base content (%) 37.5% 62.5%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 325 461 205 120 234 227
Base content per 1 kb (bases) 413 587 261 153 298 289
Base content (%) 41.3% 58.7%
CYTB (size: 1145 bases) GC AT G C A T
Base content (bases) 472 673 333 139 342 331
Base content per 1 kb (bases) 412 588 291 121 299 289
Base content (%) 41.2% 58.8%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 384 591 271 113 297 294
Base content per 1 kb (bases) 394 606 278 116 305 302
Base content (%) 39.4% 60.6%
ND2 (size: 1043 bases) GC AT G C A T
Base content (bases) 400 643 300 100 312 331
Base content per 1 kb (bases) 384 616 288 96 299 317
Base content (%) 38.4% 61.6%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 141 208 92 49 119 89
Base content per 1 kb (bases) 404 596 264 140 341 255
Base content (%) 40.4% 59.6%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 533 848 381 152 411 437
Base content per 1 kb (bases) 386 614 276 110 298 316
Base content (%) 38.6% 61.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 122 175 89 33 95 80
Base content per 1 kb (bases) 411 589 300 111 320 269
Base content (%) 41.1% 58.9%
ND5 (size: 1830 bases) GC AT G C A T
Base content (bases) 715 1115 529 186 530 585
Base content per 1 kb (bases) 391 609 289 102 290 320
Base content (%) 39.1% 60.9%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 204 318 160 44 100 218
Base content per 1 kb (bases) 391 609 307 84 192 418
Base content (%) 39.1% 60.9%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 7 (3.08%)
Threonine (Thr, T)
n = 24 (10.57%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 48 (21.15%)
Isoleucine (Ile, I)
n = 24 (10.57%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 17 (7.49%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 10 10 7 6 20 1 13 8 1 2 3 6 0 9 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 4 4 11 0 3 2 3 0 2 5 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 8 0 0 1 1 0 0 5 3 1 1 1 5 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 1 1 0 0 1 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 67 75 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 61 33 111
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 66 103 54
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPHPWFIILLFSWMIFLIILPKKVMNHTFNNNPTLKSIEKSKPEPWNWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 2 (3.64%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 6 (10.91%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 6 (10.91%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 5 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 2 1 1 1 0 3 1 0 0 0 1 0 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 4 2 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 1 0 1 1 1 0 0 0 0 0 3 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 0 5 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 14 23 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 13 17 20
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 14 26 14
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.9%)
Alanine (Ala, A)
n = 45 (8.7%)
Serine (Ser, S)
n = 31 (6.0%)
Threonine (Thr, T)
n = 34 (6.58%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 41 (7.93%)
Leucine (Leu, L)
n = 64 (12.38%)
Isoleucine (Ile, I)
n = 42 (8.12%)
Methionine (Met, M)
n = 24 (4.64%)
Proline (Pro, P)
n = 29 (5.61%)
Phenylalanine (Phe, F)
n = 39 (7.54%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 15 (2.9%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 14 24 14 7 17 0 25 8 1 11 6 18 6 28 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 1 12 11 22 0 11 13 20 2 5 6 18 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 20 1 9 7 12 0 1 2 15 4 0 1 7 8 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 0 9 5 8 0 1 1 7 0 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
157 104 126 131
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 136 96 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 110 228 169
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 16 (6.99%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 13 (5.68%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 15 (6.55%)
Leucine (Leu, L)
n = 26 (11.35%)
Isoleucine (Ile, I)
n = 23 (10.04%)
Methionine (Met, M)
n = 13 (5.68%)
Proline (Pro, P)
n = 13 (5.68%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 16 (6.99%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 5 10 6 1 5 2 12 9 0 5 2 8 0 5 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 3 8 5 0 3 2 4 0 2 5 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 7 0 4 3 6 0 1 2 7 3 0 0 2 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 16 0 3 9 4 0 2 1 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 52 60 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 55 65 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 54 100 71
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.05%)
Alanine (Ala, A)
n = 22 (8.43%)
Serine (Ser, S)
n = 12 (4.6%)
Threonine (Thr, T)
n = 23 (8.81%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.13%)
Leucine (Leu, L)
n = 35 (13.41%)
Isoleucine (Ile, I)
n = 15 (5.75%)
Methionine (Met, M)
n = 7 (2.68%)
Proline (Pro, P)
n = 13 (4.98%)
Phenylalanine (Phe, F)
n = 22 (8.43%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.83%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 8 (3.07%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 9 6 7 6 12 0 9 8 0 4 3 9 0 13 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 5 11 6 0 5 5 10 1 3 0 10 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 0 0 3 6 0 1 2 6 6 0 1 0 3 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 10 0 3 2 2 0 2 0 3 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 67 53 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 67 57 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 71 117 71
CYTB (size: 1145 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.58%)
Alanine (Ala, A)
n = 23 (6.05%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 24 (6.32%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 16 (4.21%)
Leucine (Leu, L)
n = 62 (16.32%)
Isoleucine (Ile, I)
n = 43 (11.32%)
Methionine (Met, M)
n = 13 (3.42%)
Proline (Pro, P)
n = 20 (5.26%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 17 (4.47%)
Tryptophan (Trp, W)
n = 13 (3.42%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 20 (5.26%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 22 10 9 13 30 0 10 8 1 6 4 6 0 9 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 3 15 5 0 1 9 12 3 8 5 6 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 10 0 2 10 7 0 0 3 5 12 0 0 10 10 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 0 5 4 9 0 2 1 5 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 100 112 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 86 81 162
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 147 137 89
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 25 (7.72%)
Serine (Ser, S)
n = 23 (7.1%)
Threonine (Thr, T)
n = 24 (7.41%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.4%)
Leucine (Leu, L)
n = 68 (20.99%)
Isoleucine (Ile, I)
n = 27 (8.33%)
Methionine (Met, M)
n = 15 (4.63%)
Proline (Pro, P)
n = 22 (6.79%)
Phenylalanine (Phe, F)
n = 18 (5.56%)
Tyrosine (Tyr, Y)
n = 13 (4.01%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 12 (3.7%)
Asparagine (Asn, N)
n = 13 (4.01%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 7 (2.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 15 13 10 13 24 2 19 5 0 4 2 5 0 10 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 7 7 11 0 4 4 9 1 4 9 9 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 0 2 8 8 1 1 3 9 4 0 0 7 6 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 12 0 2 1 7 0 1 1 4 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 88 90 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 90 59 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 93 145 80
ND2 (size: 1043 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.91%)
Alanine (Ala, A)
n = 24 (6.94%)
Serine (Ser, S)
n = 34 (9.83%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 72 (20.81%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 17 (4.91%)
Proline (Pro, P)
n = 18 (5.2%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 5 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 18 16 10 15 23 2 22 10 0 1 1 5 0 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 9 10 4 1 3 8 5 1 0 8 10 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 1 10 5 15 0 3 1 4 4 1 0 8 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 0 1 10 0 0 2 2 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 89 120 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 109 56 145
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 102 154 83
ND3 (size: 1043 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.91%)
Alanine (Ala, A)
n = 24 (6.94%)
Serine (Ser, S)
n = 34 (9.83%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 72 (20.81%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 17 (4.91%)
Proline (Pro, P)
n = 18 (5.2%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 15 (4.34%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 5 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 18 16 10 15 23 2 22 10 0 1 1 5 0 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 9 10 4 1 3 8 5 1 0 8 10 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 1 10 5 15 0 3 1 4 4 1 0 8 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 0 1 10 0 0 2 2 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 89 120 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 109 56 145
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 102 154 83
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.58%)
Alanine (Ala, A)
n = 32 (6.97%)
Serine (Ser, S)
n = 32 (6.97%)
Threonine (Thr, T)
n = 37 (8.06%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 90 (19.61%)
Isoleucine (Ile, I)
n = 49 (10.68%)
Methionine (Met, M)
n = 30 (6.54%)
Proline (Pro, P)
n = 25 (5.45%)
Phenylalanine (Phe, F)
n = 20 (4.36%)
Tyrosine (Tyr, Y)
n = 12 (2.61%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 17 (3.7%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 12 (2.61%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 24 26 18 19 31 2 19 11 1 3 3 4 1 9 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 4 0 7 14 11 0 5 7 9 0 7 5 13 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 17 0 4 5 14 0 2 7 6 6 0 1 7 10 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 10 0 2 3 11 0 0 1 10 0 0 0 0 0 19
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 130 153 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
64 117 79 200
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 134 205 112
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 8 (8.16%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 2 4 4 7 6 0 6 2 0 0 0 1 0 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 2 3 2 4 0 1 3 0 0 1 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 3 1 6 0 1 3 1 1 0 0 0 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 2 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
17 25 29 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 28 15 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 36 36 26
ND5 (size: 1830 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.6%)
Alanine (Ala, A)
n = 38 (6.24%)
Serine (Ser, S)
n = 51 (8.37%)
Threonine (Thr, T)
n = 48 (7.88%)
Cysteine (Cys, C)
n = 5 (0.82%)
Valine (Val, V)
n = 20 (3.28%)
Leucine (Leu, L)
n = 107 (17.57%)
Isoleucine (Ile, I)
n = 60 (9.85%)
Methionine (Met, M)
n = 27 (4.43%)
Proline (Pro, P)
n = 28 (4.6%)
Phenylalanine (Phe, F)
n = 40 (6.57%)
Tyrosine (Tyr, Y)
n = 14 (2.3%)
Tryptophan (Trp, W)
n = 13 (2.13%)
Aspartic acid (Asp, D)
n = 13 (2.13%)
Glutamic acid (Glu, E)
n = 11 (1.81%)
Asparagine (Asn, N)
n = 38 (6.24%)
Glutamine (Gln, Q)
n = 24 (3.94%)
Histidine (His, H)
n = 13 (2.13%)
Lysine (Lys, K)
n = 22 (3.61%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
33 27 25 20 22 41 1 20 24 0 4 8 5 3 12 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 4 10 22 6 0 2 10 16 0 6 8 14 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 23 2 9 11 21 0 4 6 3 11 0 3 15 23 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 11 0 8 5 22 0 0 7 2 0 0 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
110 158 205 137
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 155 136 254
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 216 244 139
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.72%)
Alanine (Ala, A)
n = 15 (8.67%)
Serine (Ser, S)
n = 10 (5.78%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 24 (13.87%)
Leucine (Leu, L)
n = 33 (19.08%)
Isoleucine (Ile, I)
n = 1 (0.58%)
Methionine (Met, M)
n = 13 (7.51%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 11 (6.36%)
Tyrosine (Tyr, Y)
n = 10 (5.78%)
Tryptophan (Trp, W)
n = 7 (4.05%)
Aspartic acid (Asp, D)
n = 1 (0.58%)
Glutamic acid (Glu, E)
n = 8 (4.62%)
Asparagine (Asn, N)
n = 4 (2.31%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 3 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 7 1 0 0 1 19 0 0 9 0 7 8 11 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 0 11 0 1 3 4 2 4 12 4 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 4 1 2 0 3 0 8 2 4 12 4 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 4 1 0 1 0 2 0 0 1 0 1 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 10 26 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 29 25 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 5 49 68
Total protein-coding genes (size: 11425 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 225 (5.91%)
Alanine (Ala, A)
n = 279 (7.33%)
Serine (Ser, S)
n = 265 (6.96%)
Threonine (Thr, T)
n = 279 (7.33%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 177 (4.65%)
Leucine (Leu, L)
n = 665 (17.48%)
Isoleucine (Ile, I)
n = 345 (9.07%)
Methionine (Met, M)
n = 179 (4.7%)
Proline (Pro, P)
n = 206 (5.41%)
Phenylalanine (Phe, F)
n = 231 (6.07%)
Tyrosine (Tyr, Y)
n = 123 (3.23%)
Tryptophan (Trp, W)
n = 120 (3.15%)
Aspartic acid (Asp, D)
n = 69 (1.81%)
Glutamic acid (Glu, E)
n = 104 (2.73%)
Asparagine (Asn, N)
n = 153 (4.02%)
Glutamine (Gln, Q)
n = 100 (2.63%)
Histidine (His, H)
n = 100 (2.63%)
Lysine (Lys, K)
n = 81 (2.13%)
Arginine (Arg, R)
n = 72 (1.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
191 154 153 116 112 220 12 186 96 4 50 32 77 18 116 115
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
26 14 11 76 106 92 5 44 67 94 20 46 55 104 1 47
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
96 131 5 50 59 101 2 19 34 68 55 6 19 69 84 55
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
45 100 4 35 34 81 0 12 17 40 3 0 1 7 0 114
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
854 938 1091 923
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
496 976 737 1597
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
126 1076 1596 1008

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.