Viewing data for Ailuropoda melanoleuca


Scientific name Ailuropoda melanoleuca
Common name Giant panda
Maximum lifespan 36.80 years (Ailuropoda melanoleuca@AnAge)

Total mtDNA (size: 16805 bases) GC AT G C A T
Base content (bases) 6518 10287 4000 2518 4949 5338
Base content per 1 kb (bases) 388 612 238 150 294 318
Base content (%) 38.8% 61.2%
Total protein-coding genes (size: 11339 bases) GC AT G C A T
Base content (bases) 4337 7002 2805 1532 3473 3529
Base content per 1 kb (bases) 382 618 247 135 306 311
Base content (%) 38.2% 61.8%
D-loop (size: 1354 bases) GC AT G C A T
Base content (bases) 607 747 346 261 394 353
Base content per 1 kb (bases) 448 552 256 193 291 261
Base content (%) 44.8% 55.2%
Total tRNA-coding genes (size: 1509 bases) GC AT G C A T
Base content (bases) 560 949 315 245 430 519
Base content per 1 kb (bases) 371 629 209 162 285 344
Base content (%) 37.1% 62.9%
Total rRNA-coding genes (size: 2547 bases) GC AT G C A T
Base content (bases) 990 1557 521 469 641 916
Base content per 1 kb (bases) 389 611 205 184 252 360
Base content (%) 38.9% 61.1%
12S rRNA gene (size: 966 bases) GC AT G C A T
Base content (bases) 388 578 210 178 236 342
Base content per 1 kb (bases) 402 598 217 184 244 354
Base content (%) 40.2% 59.8%
16S rRNA gene (size: 1581 bases) GC AT G C A T
Base content (bases) 602 979 311 291 405 574
Base content per 1 kb (bases) 381 619 197 184 256 363
Base content (%) 38.1% 61.9%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 249 432 162 87 229 203
Base content per 1 kb (bases) 366 634 238 128 336 298
Base content (%) 36.6% 63.4%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 66 138 48 18 59 79
Base content per 1 kb (bases) 324 676 235 88 289 387
Base content (%) 32.4% 67.6%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 633 912 356 277 496 416
Base content per 1 kb (bases) 410 590 230 179 321 269
Base content (%) 41.0% 59.0%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 249 435 146 103 203 232
Base content per 1 kb (bases) 364 636 213 151 297 339
Base content (%) 36.4% 63.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 317 467 193 124 253 214
Base content per 1 kb (bases) 404 596 246 158 323 273
Base content (%) 40.4% 59.6%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 452 688 288 164 356 332
Base content per 1 kb (bases) 396 604 253 144 312 291
Base content (%) 39.6% 60.4%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 370 586 252 118 293 293
Base content per 1 kb (bases) 387 613 264 123 306 306
Base content (%) 38.7% 61.3%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 362 680 266 96 304 376
Base content per 1 kb (bases) 347 653 255 92 292 361
Base content (%) 34.7% 65.3%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 128 219 81 47 117 102
Base content per 1 kb (bases) 369 631 233 135 337 294
Base content (%) 36.9% 63.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 518 860 341 177 434 426
Base content per 1 kb (bases) 376 624 247 128 315 309
Base content (%) 37.6% 62.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 114 183 71 43 102 81
Base content per 1 kb (bases) 384 616 239 145 343 273
Base content (%) 38.4% 61.6%
ND5 (size: 1830 bases) GC AT G C A T
Base content (bases) 710 1120 481 229 530 590
Base content per 1 kb (bases) 388 612 263 125 290 322
Base content (%) 38.8% 61.2%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 196 332 138 58 121 211
Base content per 1 kb (bases) 371 629 261 110 229 400
Base content (%) 37.1% 62.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 12 (5.31%)
Threonine (Thr, T)
n = 20 (8.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (6.64%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 11 (4.87%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 8 (3.54%)
Histidine (His, H)
n = 8 (3.54%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 6 7 6 1 14 8 14 8 0 5 1 7 2 7 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 6 6 3 1 1 3 6 1 7 2 5 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 6 0 4 0 5 0 3 0 2 1 0 0 7 5 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 1 0 2 2 0 1 3 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 63 77 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 59 40 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 40 86 81
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFITILSMILTLFIMFQLKVSKHNYPEFPELKTTPLSKKPMPWEEKWTKICSPLLLPQW*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 5 (7.46%)
Threonine (Thr, T)
n = 7 (10.45%)
Cysteine (Cys, C)
n = 1 (1.49%)
Valine (Val, V)
n = 1 (1.49%)
Leucine (Leu, L)
n = 10 (14.93%)
Isoleucine (Ile, I)
n = 5 (7.46%)
Methionine (Met, M)
n = 4 (5.97%)
Proline (Pro, P)
n = 8 (11.94%)
Phenylalanine (Phe, F)
n = 4 (5.97%)
Tyrosine (Tyr, Y)
n = 1 (1.49%)
Tryptophan (Trp, W)
n = 4 (5.97%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 4 (5.97%)
Asparagine (Asn, N)
n = 1 (1.49%)
Glutamine (Gln, Q)
n = 3 (4.48%)
Histidine (His, H)
n = 1 (1.49%)
Lysine (Lys, K)
n = 7 (10.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 1 1 0 4 0 5 2 1 0 1 0 0 4 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 0 0 0 0 0 0 0 0 5 1 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 1 0 2 2 1 0 0 1 0 0 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 1 0 1 7 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 17 24 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 20 19 24
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 11 36 14
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 43 (8.37%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 36 (7.0%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 58 (11.28%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 34 (6.61%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 18 (3.5%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 14 (2.72%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 18 (3.5%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 19 (3.7%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 9 23 13 6 20 8 10 4 2 8 7 17 6 19 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 1 0 10 12 20 1 10 10 20 7 13 8 5 2 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 17 1 10 4 11 2 1 2 12 6 3 1 10 8 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 3 8 6 7 2 1 0 7 0 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 108 138 117
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 95 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
49 114 183 169
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 19 (8.37%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 18 (7.93%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 5 12 5 2 11 2 10 7 0 2 1 7 2 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 2 3 1 4 1 1 2 3 2 0 5 6 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 10 0 4 4 6 1 1 3 8 2 0 1 5 1 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 10 5 8 2 3 2 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 54 70 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 56 62 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 36 100 68
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 6 8 11 3 13 1 4 7 0 5 3 8 2 16 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 3 3 7 2 3 3 11 2 3 1 6 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 7 0 4 3 8 2 2 2 6 6 3 0 1 5 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 1 2 2 2 0 0 1 3 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 68 58 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 64 56 99
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 61 100 82
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 27 (7.12%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 25 (6.6%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 16 11 7 6 26 5 11 5 1 2 7 6 3 18 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 2 5 9 9 0 2 4 11 7 8 3 13 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 16 0 6 5 11 0 2 3 7 7 3 2 7 9 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 3 3 4 7 8 1 0 0 8 0 1 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 95 110 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 95 74 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 98 148 106
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 20 (6.31%)
Threonine (Thr, T)
n = 23 (7.26%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 17 (5.36%)
Leucine (Leu, L)
n = 55 (17.35%)
Isoleucine (Ile, I)
n = 27 (8.52%)
Methionine (Met, M)
n = 19 (5.99%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 21 (6.62%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 5 (1.58%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 10 17 8 6 31 3 7 5 1 2 4 11 0 13 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 8 12 9 0 3 3 5 1 8 4 9 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 8 5 5 3 9 0 1 2 6 5 0 0 6 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 0 1 2 7 0 0 0 8 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 89 91 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 91 55 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 72 146 87
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 22 (6.36%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 34 (9.83%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 13 31 7 5 33 1 9 8 0 6 2 3 1 9 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 7 7 8 0 0 7 8 0 6 3 11 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 26 0 4 9 12 0 0 3 6 4 1 1 9 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 1 1 13 1 0 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 82 140 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 108 58 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 76 178 85
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 22 (6.36%)
Serine (Ser, S)
n = 28 (8.09%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 34 (9.83%)
Methionine (Met, M)
n = 34 (9.83%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 14 (4.05%)
Glutamine (Gln, Q)
n = 8 (2.31%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 13 31 7 5 33 1 9 8 0 6 2 3 1 9 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 7 7 8 0 0 7 8 0 6 3 11 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 26 0 4 9 12 0 0 3 6 4 1 1 9 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 1 1 13 1 0 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 82 140 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 108 58 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 76 178 85
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 40 (8.73%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 19 (4.15%)
Leucine (Leu, L)
n = 94 (20.52%)
Isoleucine (Ile, I)
n = 34 (7.42%)
Methionine (Met, M)
n = 35 (7.64%)
Proline (Pro, P)
n = 21 (4.59%)
Phenylalanine (Phe, F)
n = 19 (4.15%)
Tyrosine (Tyr, Y)
n = 19 (4.15%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 22 (4.8%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 8 (1.75%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 10 30 13 13 31 11 23 7 4 6 1 11 1 10 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 3 0 10 8 12 1 1 6 8 3 8 7 4 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 21 1 11 8 7 0 7 4 10 9 1 3 10 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 3 1 3 9 4 0 1 6 3 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 118 155 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 118 85 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 105 186 126
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 5 2 3 10 2 5 2 0 1 2 4 1 3 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 1 3 2 1 0 1 1 2 0 0 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 3 4 1 0 2 0 3 1 0 1 3 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 23 27 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 22 17 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 26 37 25
ND5 (size: 1830 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.76%)
Alanine (Ala, A)
n = 42 (6.9%)
Serine (Ser, S)
n = 43 (7.06%)
Threonine (Thr, T)
n = 59 (9.69%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 24 (3.94%)
Leucine (Leu, L)
n = 88 (14.45%)
Isoleucine (Ile, I)
n = 55 (9.03%)
Methionine (Met, M)
n = 38 (6.24%)
Proline (Pro, P)
n = 25 (4.11%)
Phenylalanine (Phe, F)
n = 47 (7.72%)
Tyrosine (Tyr, Y)
n = 17 (2.79%)
Tryptophan (Trp, W)
n = 13 (2.13%)
Aspartic acid (Asp, D)
n = 10 (1.64%)
Glutamic acid (Glu, E)
n = 13 (2.13%)
Asparagine (Asn, N)
n = 31 (5.09%)
Glutamine (Gln, Q)
n = 21 (3.45%)
Histidine (His, H)
n = 16 (2.63%)
Lysine (Lys, K)
n = 23 (3.78%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 26 32 15 12 44 5 10 18 3 3 8 12 1 27 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 4 5 18 18 1 3 4 20 2 6 8 10 1 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 22 6 7 12 10 1 7 6 8 9 2 2 15 16 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 8 5 7 3 17 6 1 2 6 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
118 147 219 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 156 132 252
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 178 239 152
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.71%)
Alanine (Ala, A)
n = 10 (5.71%)
Serine (Ser, S)
n = 15 (8.57%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 23 (13.14%)
Leucine (Leu, L)
n = 21 (12.0%)
Isoleucine (Ile, I)
n = 14 (8.0%)
Methionine (Met, M)
n = 8 (4.57%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 12 (6.86%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 2 4 3 1 1 2 10 1 0 7 3 10 3 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 4 3 2 1 9 0 9 6 2 1 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 1 8 0 1 0 5 1 6 3 1 4 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 5 4 1 0 4 1 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 12 43 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 30 31 78
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 16 47 82
Total protein-coding genes (size: 11416 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 214 (5.63%)
Alanine (Ala, A)
n = 260 (6.84%)
Serine (Ser, S)
n = 273 (7.18%)
Threonine (Thr, T)
n = 310 (8.15%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 209 (5.5%)
Leucine (Leu, L)
n = 598 (15.73%)
Isoleucine (Ile, I)
n = 318 (8.36%)
Methionine (Met, M)
n = 241 (6.34%)
Proline (Pro, P)
n = 197 (5.18%)
Phenylalanine (Phe, F)
n = 239 (6.29%)
Tyrosine (Tyr, Y)
n = 131 (3.45%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 100 (2.63%)
Asparagine (Asn, N)
n = 151 (3.97%)
Glutamine (Gln, Q)
n = 88 (2.31%)
Histidine (His, H)
n = 101 (2.66%)
Lysine (Lys, K)
n = 100 (2.63%)
Arginine (Arg, R)
n = 64 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
208 110 187 97 62 248 50 126 75 13 48 40 99 22 143 96
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
54 16 11 66 85 100 9 33 43 104 34 70 43 73 11 82
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
70 143 15 68 55 84 7 32 27 78 53 15 15 77 74 53
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
48 72 28 38 30 78 22 3 8 49 4 1 0 7 0 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
851 907 1180 865
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
471 981 746 1605
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
299 855 1537 1112

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.