Viewing data for Capreolus capreolus


Scientific name Capreolus capreolus
Common name Western roe deer
Maximum lifespan 17.50 years (Capreolus capreolus@AnAge)

Total mtDNA (size: 16358 bases) GC AT G C A T
Base content (bases) 5977 10378 3800 2177 4908 5470
Base content per 1 kb (bases) 365 634 232 133 300 334
Base content (%) 36.5% 63.4%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4107 7228 2748 1359 3550 3678
Base content per 1 kb (bases) 362 638 242 120 313 324
Base content (%) 36.2% 63.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1512 bases) GC AT G C A T
Base content (bases) 550 962 318 232 421 541
Base content per 1 kb (bases) 364 636 210 153 278 358
Base content (%) 36.4% 63.6%
Total rRNA-coding genes (size: 2524 bases) GC AT G C A T
Base content (bases) 952 1572 515 437 622 950
Base content per 1 kb (bases) 377 623 204 173 246 376
Base content (%) 37.7% 62.3%
12S rRNA gene (size: 955 bases) GC AT G C A T
Base content (bases) 374 581 205 169 225 356
Base content per 1 kb (bases) 392 608 215 177 236 373
Base content (%) 39.2% 60.8%
16S rRNA gene (size: 1569 bases) GC AT G C A T
Base content (bases) 578 991 310 268 397 594
Base content per 1 kb (bases) 368 632 198 171 253 379
Base content (%) 36.8% 63.2%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 248 433 167 81 223 210
Base content per 1 kb (bases) 364 636 245 119 327 308
Base content (%) 36.4% 63.6%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 59 142 43 16 61 81
Base content per 1 kb (bases) 294 706 214 80 303 403
Base content (%) 29.4% 70.6%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 570 975 323 247 526 449
Base content per 1 kb (bases) 369 631 209 160 340 291
Base content (%) 36.9% 63.1%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 248 436 154 94 198 238
Base content per 1 kb (bases) 363 637 225 137 289 348
Base content (%) 36.3% 63.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 332 449 221 111 238 211
Base content per 1 kb (bases) 423 573 282 142 304 269
Base content (%) 42.3% 57.3%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 447 693 302 145 332 361
Base content per 1 kb (bases) 392 608 265 127 291 317
Base content (%) 39.2% 60.8%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 346 610 235 111 304 306
Base content per 1 kb (bases) 362 638 246 116 318 320
Base content (%) 36.2% 63.8%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 334 708 244 90 327 381
Base content per 1 kb (bases) 321 679 234 86 314 366
Base content (%) 32.1% 67.9%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 126 220 86 40 113 107
Base content per 1 kb (bases) 364 636 249 116 327 309
Base content (%) 36.4% 63.6%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 501 877 344 157 445 432
Base content per 1 kb (bases) 364 636 250 114 323 313
Base content (%) 36.4% 63.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 106 191 67 39 100 91
Base content per 1 kb (bases) 357 643 226 131 337 306
Base content (%) 35.7% 64.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 629 1192 434 195 578 614
Base content per 1 kb (bases) 345 655 238 107 317 337
Base content (%) 34.5% 65.5%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 179 349 138 41 130 219
Base content per 1 kb (bases) 339 661 261 78 246 415
Base content (%) 33.9% 66.1%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (5.31%)
Alanine (Ala, A)
n = 18 (7.96%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 21 (9.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 4 11 12 3 11 2 13 8 1 2 3 6 0 11 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 7 8 0 0 5 6 1 4 1 7 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 11 0 1 4 4 0 2 4 0 2 1 2 6 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 2 1 1 0 3 1 2 1 1 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
45 59 80 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 60 36 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 48 94 74
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLMMIMSMFLVLFIIFQLKISKHNFYFNPESKLAKTQKQSTPWETKWTKIYLPLLLSQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.52%)
Serine (Ser, S)
n = 6 (9.09%)
Threonine (Thr, T)
n = 6 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.52%)
Leucine (Leu, L)
n = 10 (15.15%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 5 (7.58%)
Proline (Pro, P)
n = 4 (6.06%)
Phenylalanine (Phe, F)
n = 5 (7.58%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 2 (3.03%)
Glutamine (Gln, Q)
n = 5 (7.58%)
Histidine (His, H)
n = 1 (1.52%)
Lysine (Lys, K)
n = 7 (10.61%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 4 1 2 2 0 3 5 0 0 0 1 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 0 0 0 0 0 0 2 0 1 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 4 1 1 1 3 0 0 1 2 0 0 2 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 6 1 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 15 26 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 16 21 26
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 12 34 14
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 39 (7.59%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (7.0%)
Leucine (Leu, L)
n = 60 (11.67%)
Isoleucine (Ile, I)
n = 39 (7.59%)
Methionine (Met, M)
n = 34 (6.61%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 14 (2.72%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 20 (3.89%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 10 30 9 4 19 5 21 6 0 14 6 15 1 27 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 14 7 18 0 13 7 21 6 12 7 9 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 18 2 10 2 14 1 3 0 11 8 0 2 14 6 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 3 8 6 9 0 1 1 5 1 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
146 96 143 130
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 132 96 211
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 95 210 185
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 7 9 2 3 11 2 15 6 0 4 4 4 2 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 2 1 3 4 0 3 0 5 0 4 1 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 12 0 7 1 8 0 3 2 5 5 0 1 2 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 14 1 5 5 5 1 0 1 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 50 66 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 60 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 49 112 54
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 3 (1.15%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 14 (5.38%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 6 (2.31%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 7 8 6 4 12 3 7 7 0 3 8 2 0 7 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 2 9 3 0 4 7 6 2 2 4 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 9 0 3 4 8 0 2 3 8 3 1 1 2 4 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 1 2 2 3 1 2 1 1 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 67 63 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 55 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 88 90 70
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 24 (6.33%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 43 (11.35%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 19 (5.01%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 21 12 7 11 26 2 9 6 0 4 4 9 0 12 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 4 3 16 1 2 6 15 1 2 4 16 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 16 1 6 3 11 0 2 1 5 10 0 1 6 13 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 1 3 7 9 0 0 1 6 1 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 94 116 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 93 76 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 115 169 84
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 23 (7.26%)
Threonine (Thr, T)
n = 19 (5.99%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 14 (4.42%)
Leucine (Leu, L)
n = 54 (17.03%)
Isoleucine (Ile, I)
n = 33 (10.41%)
Methionine (Met, M)
n = 18 (5.68%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 22 (6.94%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 8 17 6 5 27 1 14 6 1 2 2 9 1 14 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 6 8 14 0 1 5 5 1 7 5 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 12 1 4 4 12 0 0 3 8 3 2 1 7 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 1 2 7 0 0 1 7 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 79 93 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 89 55 141
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 67 157 84
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 16 (4.62%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (4.34%)
Leucine (Leu, L)
n = 52 (15.03%)
Isoleucine (Ile, I)
n = 33 (9.54%)
Methionine (Met, M)
n = 45 (13.01%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 11 41 7 5 23 3 13 10 0 5 4 5 1 12 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 4 7 0 1 5 8 0 4 4 12 0 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 15 0 6 6 15 0 1 2 4 4 0 1 7 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 0 1 0 11 0 1 0 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 76 147 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 101 57 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 67 177 94
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 16 (4.62%)
Serine (Ser, S)
n = 30 (8.67%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (4.34%)
Leucine (Leu, L)
n = 52 (15.03%)
Isoleucine (Ile, I)
n = 33 (9.54%)
Methionine (Met, M)
n = 45 (13.01%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 11 41 7 5 23 3 13 10 0 5 4 5 1 12 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 5 4 7 0 1 5 8 0 4 4 12 0 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 15 0 6 6 15 0 1 2 4 4 0 1 7 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 0 1 0 11 0 1 0 2 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 76 147 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 101 57 159
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 67 177 94
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 27 (5.9%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 36 (7.86%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 18 (3.93%)
Leucine (Leu, L)
n = 90 (19.65%)
Isoleucine (Ile, I)
n = 38 (8.3%)
Methionine (Met, M)
n = 39 (8.52%)
Proline (Pro, P)
n = 20 (4.37%)
Phenylalanine (Phe, F)
n = 23 (5.02%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 9 35 16 14 26 6 26 10 1 5 4 6 3 13 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 3 4 14 6 3 1 7 9 0 7 7 6 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 22 0 7 9 12 0 3 9 10 7 1 2 9 14 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 7 2 2 1 9 2 0 3 3 4 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 114 159 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 111 85 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 119 188 124
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 7 2 3 9 0 8 2 0 0 1 5 2 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 1 1 5 1 1 1 2 0 1 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 1 2 5 2 0 1 0 2 2 0 0 5 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 20 27 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 25 17 48
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 22 47 23
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 39 (6.44%)
Serine (Ser, S)
n = 50 (8.25%)
Threonine (Thr, T)
n = 54 (8.91%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 17 (2.81%)
Leucine (Leu, L)
n = 82 (13.53%)
Isoleucine (Ile, I)
n = 62 (10.23%)
Methionine (Met, M)
n = 47 (7.76%)
Proline (Pro, P)
n = 25 (4.13%)
Phenylalanine (Phe, F)
n = 50 (8.25%)
Tyrosine (Tyr, Y)
n = 17 (2.81%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 35 (5.78%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
45 17 44 12 9 35 3 20 18 1 5 4 7 1 32 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 3 7 9 22 1 4 13 11 0 8 7 10 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 28 0 8 12 15 1 3 11 13 4 3 3 16 19 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 2 7 4 19 3 0 5 3 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
107 122 234 144
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 154 128 258
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 158 252 176
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.29%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 10 (5.71%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 24 (13.71%)
Leucine (Leu, L)
n = 18 (10.29%)
Isoleucine (Ile, I)
n = 15 (8.57%)
Methionine (Met, M)
n = 11 (6.29%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 13 (7.43%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 2 (1.14%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (1.71%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 0 6 1 0 2 0 11 0 2 9 0 9 6 13 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 4 1 0 1 11 1 6 7 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 2 5 0 2 0 4 1 8 2 1 4 3 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 4 5 4 0 2 1 1 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 9 48 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 26 33 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 6 49 87
Total protein-coding genes (size: 11403 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 213 (5.61%)
Alanine (Ala, A)
n = 239 (6.29%)
Serine (Ser, S)
n = 287 (7.56%)
Threonine (Thr, T)
n = 304 (8.0%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 193 (5.08%)
Leucine (Leu, L)
n = 580 (15.27%)
Isoleucine (Ile, I)
n = 337 (8.87%)
Methionine (Met, M)
n = 266 (7.0%)
Proline (Pro, P)
n = 191 (5.03%)
Phenylalanine (Phe, F)
n = 254 (6.69%)
Tyrosine (Tyr, Y)
n = 129 (3.4%)
Tryptophan (Trp, W)
n = 103 (2.71%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 164 (4.32%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 91 (2.4%)
Lysine (Lys, K)
n = 96 (2.53%)
Arginine (Arg, R)
n = 62 (1.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
240 97 229 84 68 215 27 166 86 7 55 40 80 17 155 99
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
37 8 17 54 72 106 7 41 57 97 18 58 42 89 2 81
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
58 157 8 61 51 110 2 24 39 78 51 10 20 81 83 38
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
53 79 17 36 30 86 10 7 15 34 6 1 0 6 1 93
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
806 831 1231 928
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
467 958 742 1629
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
189 872 1634 1101

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.