Viewing data for Bombina orientalis


Scientific name Bombina orientalis
Common name Oriental firebelly toad
Maximum lifespan 15.80 years (Bombina orientalis@AnAge)

Total mtDNA (size: 17847 bases) GC AT G C A T
Base content (bases) 7532 10315 4761 2771 4966 5349
Base content per 1 kb (bases) 422 578 267 155 278 300
Base content (%) 42.2% 57.8%
Total protein-coding genes (size: 11341 bases) GC AT G C A T
Base content (bases) 4913 6428 3254 1659 3211 3217
Base content per 1 kb (bases) 433 567 287 146 283 284
Base content (%) 43.3% 56.7%
D-loop (size: 2372 bases) GC AT G C A T
Base content (bases) 802 1570 473 329 807 763
Base content per 1 kb (bases) 338 662 199 139 340 322
Base content (%) 33.8% 66.2%
Total tRNA-coding genes (size: 1534 bases) GC AT G C A T
Base content (bases) 670 864 383 287 389 475
Base content per 1 kb (bases) 437 563 250 187 254 310
Base content (%) 43.7% 56.3%
Total rRNA-coding genes (size: 2532 bases) GC AT G C A T
Base content (bases) 1116 1416 633 483 539 877
Base content per 1 kb (bases) 441 559 250 191 213 346
Base content (%) 44.1% 55.9%
12S rRNA gene (size: 933 bases) GC AT G C A T
Base content (bases) 441 492 249 192 184 308
Base content per 1 kb (bases) 473 527 267 206 197 330
Base content (%) 47.3% 52.7%
16S rRNA gene (size: 1599 bases) GC AT G C A T
Base content (bases) 675 924 384 291 355 569
Base content per 1 kb (bases) 422 578 240 182 222 356
Base content (%) 42.2% 57.8%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 284 400 201 83 205 195
Base content per 1 kb (bases) 415 585 294 121 300 285
Base content (%) 41.5% 58.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 69 99 52 17 37 62
Base content per 1 kb (bases) 411 589 310 101 220 369
Base content (%) 41.1% 58.9%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 691 863 408 283 456 407
Base content per 1 kb (bases) 445 555 263 182 293 262
Base content (%) 44.5% 55.5%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 279 409 172 107 195 214
Base content per 1 kb (bases) 406 594 250 156 283 311
Base content (%) 40.6% 59.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 352 432 216 136 236 196
Base content per 1 kb (bases) 449 551 276 173 301 250
Base content (%) 44.9% 55.1%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 510 631 343 167 334 297
Base content per 1 kb (bases) 447 553 301 146 293 260
Base content (%) 44.7% 55.3%
ND1 (size: 962 bases) GC AT G C A T
Base content (bases) 412 550 276 136 297 253
Base content per 1 kb (bases) 428 572 287 141 309 263
Base content (%) 42.8% 57.2%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 460 585 328 132 261 324
Base content per 1 kb (bases) 440 560 314 126 250 310
Base content (%) 44.0% 56.0%
ND3 (size: 343 bases) GC AT G C A T
Base content (bases) 147 196 94 53 114 82
Base content per 1 kb (bases) 429 571 274 155 332 239
Base content (%) 42.9% 57.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 594 784 405 189 398 386
Base content per 1 kb (bases) 431 569 294 137 289 280
Base content (%) 43.1% 56.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 146 151 94 52 85 66
Base content per 1 kb (bases) 492 508 316 175 286 222
Base content (%) 49.2% 50.8%
ND5 (size: 1809 bases) GC AT G C A T
Base content (bases) 750 1059 514 236 523 536
Base content per 1 kb (bases) 415 585 284 130 289 296
Base content (%) 41.5% 58.5%
ND6 (size: 510 bases) GC AT G C A T
Base content (bases) 225 285 155 70 76 209
Base content per 1 kb (bases) 441 559 304 137 149 410
Base content (%) 44.1% 55.9%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.41%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 12 (5.29%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.41%)
Leucine (Leu, L)
n = 51 (22.47%)
Isoleucine (Ile, I)
n = 27 (11.89%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 13 (5.73%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 12 (5.29%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 7 6 14 10 10 6 9 8 0 1 2 5 2 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 9 6 0 2 2 5 1 5 2 9 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 12 1 1 2 4 0 1 4 0 3 0 2 1 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 1 0 1 1 0 2 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 73 74 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 60 34 110
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 68 87 56
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPSPWFAILMFSWLILLTVYPQKVTKHLSTNEPATQNTEKSKPTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 8 (14.55%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 1 0 3 1 1 1 2 1 2 0 0 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 0 0 0 0 0 0 0 1 1 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 1 0 2 0 0 1 0 1 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 0 0 3 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 17 20 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 21 15 14
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 14 27 10
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.09%)
Alanine (Ala, A)
n = 43 (8.32%)
Serine (Ser, S)
n = 29 (5.61%)
Threonine (Thr, T)
n = 42 (8.12%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.74%)
Leucine (Leu, L)
n = 62 (11.99%)
Isoleucine (Ile, I)
n = 37 (7.16%)
Methionine (Met, M)
n = 28 (5.42%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 40 (7.74%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 15 (2.9%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 13 19 14 9 16 2 17 5 2 11 9 13 7 20 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 1 6 21 15 1 7 17 17 6 7 9 11 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 20 3 6 3 12 4 1 3 8 11 1 4 7 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 4 7 3 12 8 0 2 1 4 2 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
156 104 134 124
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 138 95 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
49 166 178 125
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 17 (7.46%)
Serine (Ser, S)
n = 16 (7.02%)
Threonine (Thr, T)
n = 19 (8.33%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 15 (6.58%)
Leucine (Leu, L)
n = 24 (10.53%)
Isoleucine (Ile, I)
n = 19 (8.33%)
Methionine (Met, M)
n = 15 (6.58%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 10 (4.39%)
Tyrosine (Tyr, Y)
n = 7 (3.07%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 11 (4.82%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 7 (3.07%)
Glutamine (Gln, Q)
n = 8 (3.51%)
Histidine (His, H)
n = 8 (3.51%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 5 11 5 3 8 0 7 6 2 8 4 2 1 9 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 2 8 7 0 3 1 3 1 1 3 9 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 8 2 4 2 6 0 3 1 4 3 0 1 3 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 10 4 2 9 3 1 2 2 2 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 52 68 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 62 59 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 58 87 67
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 18 (6.92%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 14 (5.38%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 4 6 13 5 6 4 4 9 0 6 4 5 2 14 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 2 12 8 1 3 10 8 0 4 2 5 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 10 2 2 3 6 0 0 4 5 6 0 0 1 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 2 7 2 2 3 0 2 1 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 68 55 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 64 55 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 84 86 73
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (7.12%)
Alanine (Ala, A)
n = 28 (7.39%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 22 (5.8%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 60 (15.83%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 10 (2.64%)
Proline (Pro, P)
n = 23 (6.07%)
Phenylalanine (Phe, F)
n = 34 (8.97%)
Tyrosine (Tyr, Y)
n = 12 (3.17%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 22 7 10 17 16 4 10 5 2 1 11 5 0 15 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 5 13 9 1 2 9 10 6 4 7 10 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 0 3 4 12 2 1 2 5 7 1 3 4 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 2 3 6 9 0 1 2 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
87 96 101 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 94 72 160
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 153 124 77
ND1 (size: 962 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (5.02%)
Alanine (Ala, A)
n = 26 (8.15%)
Serine (Ser, S)
n = 24 (7.52%)
Threonine (Thr, T)
n = 22 (6.9%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 16 (5.02%)
Leucine (Leu, L)
n = 58 (18.18%)
Isoleucine (Ile, I)
n = 31 (9.72%)
Methionine (Met, M)
n = 14 (4.39%)
Proline (Pro, P)
n = 20 (6.27%)
Phenylalanine (Phe, F)
n = 20 (6.27%)
Tyrosine (Tyr, Y)
n = 12 (3.76%)
Tryptophan (Trp, W)
n = 9 (2.82%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.45%)
Asparagine (Asn, N)
n = 11 (3.45%)
Glutamine (Gln, Q)
n = 8 (2.51%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.19%)
Arginine (Arg, R)
n = 8 (2.51%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 16 9 14 11 14 6 11 7 1 5 4 4 3 13 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 2 19 5 0 2 6 6 2 3 3 13 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 7 0 9 5 6 1 1 2 2 10 1 2 7 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 7 4 1 2 7 0 0 2 5 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 84 88 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 89 55 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 103 109 81
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 32 (9.22%)
Serine (Ser, S)
n = 35 (10.09%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 29 (8.36%)
Methionine (Met, M)
n = 23 (6.63%)
Proline (Pro, P)
n = 17 (4.9%)
Phenylalanine (Phe, F)
n = 10 (2.88%)
Tyrosine (Tyr, Y)
n = 5 (1.44%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 8 (2.31%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 11 (3.17%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 17 19 10 17 21 4 8 8 4 1 3 3 2 6 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 19 8 2 2 3 9 1 5 5 6 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 24 4 4 9 14 2 1 5 4 1 2 2 4 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 1 0 3 9 2 0 1 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 93 125 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 126 53 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 109 146 62
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 32 (9.22%)
Serine (Ser, S)
n = 35 (10.09%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 29 (8.36%)
Methionine (Met, M)
n = 23 (6.63%)
Proline (Pro, P)
n = 17 (4.9%)
Phenylalanine (Phe, F)
n = 10 (2.88%)
Tyrosine (Tyr, Y)
n = 5 (1.44%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 8 (2.31%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 11 (3.17%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 17 19 10 17 21 4 8 8 4 1 3 3 2 6 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 3 19 8 2 2 3 9 1 5 5 6 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 24 4 4 9 14 2 1 5 4 1 2 2 4 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 1 0 3 9 2 0 1 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 93 125 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 126 53 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 109 146 62
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (4.8%)
Alanine (Ala, A)
n = 37 (8.08%)
Serine (Ser, S)
n = 43 (9.39%)
Threonine (Thr, T)
n = 39 (8.52%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 14 (3.06%)
Leucine (Leu, L)
n = 86 (18.78%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 29 (6.33%)
Proline (Pro, P)
n = 26 (5.68%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 11 (2.4%)
Tryptophan (Trp, W)
n = 17 (3.71%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 7 (1.53%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 17 21 16 15 27 8 13 9 3 5 3 6 0 12 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 2 2 3 20 14 0 3 9 4 6 1 8 15 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 17 1 9 16 9 0 4 5 6 5 1 7 7 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 2 1 2 6 1 3 1 6 1 0 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 128 143 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
63 136 72 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
40 141 171 107
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (7.14%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 4 4 6 6 4 1 2 0 1 0 0 1 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 3 2 5 2 0 0 3 3 1 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 6 1 3 2 3 1 0 2 0 0 0 3 0 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 0 2 0 1 0 0 1 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 30 22 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 29 13 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 35 31 19
ND5 (size: 1809 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.82%)
Alanine (Ala, A)
n = 48 (7.97%)
Serine (Ser, S)
n = 48 (7.97%)
Threonine (Thr, T)
n = 54 (8.97%)
Cysteine (Cys, C)
n = 7 (1.16%)
Valine (Val, V)
n = 25 (4.15%)
Leucine (Leu, L)
n = 97 (16.11%)
Isoleucine (Ile, I)
n = 60 (9.97%)
Methionine (Met, M)
n = 25 (4.15%)
Proline (Pro, P)
n = 29 (4.82%)
Phenylalanine (Phe, F)
n = 38 (6.31%)
Tyrosine (Tyr, Y)
n = 10 (1.66%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 15 (2.49%)
Glutamic acid (Glu, E)
n = 10 (1.66%)
Asparagine (Asn, N)
n = 30 (4.98%)
Glutamine (Gln, Q)
n = 19 (3.16%)
Histidine (His, H)
n = 16 (2.66%)
Lysine (Lys, K)
n = 21 (3.49%)
Arginine (Arg, R)
n = 9 (1.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 30 19 25 19 25 7 19 17 2 6 6 11 2 25 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 2 5 10 18 19 1 3 11 11 4 8 7 10 4 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 25 3 7 13 14 1 6 7 4 6 2 2 12 18 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 3 3 12 19 2 1 4 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
127 149 203 124
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 166 122 245
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 199 211 154
ND6 (size: 510 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (14.2%)
Alanine (Ala, A)
n = 16 (9.47%)
Serine (Ser, S)
n = 13 (7.69%)
Threonine (Thr, T)
n = 5 (2.96%)
Cysteine (Cys, C)
n = 2 (1.18%)
Valine (Val, V)
n = 26 (15.38%)
Leucine (Leu, L)
n = 30 (17.75%)
Isoleucine (Ile, I)
n = 5 (2.96%)
Methionine (Met, M)
n = 6 (3.55%)
Proline (Pro, P)
n = 4 (2.37%)
Phenylalanine (Phe, F)
n = 10 (5.92%)
Tyrosine (Tyr, Y)
n = 12 (7.1%)
Tryptophan (Trp, W)
n = 3 (1.78%)
Aspartic acid (Asp, D)
n = 1 (0.59%)
Glutamic acid (Glu, E)
n = 5 (2.96%)
Asparagine (Asn, N)
n = 2 (1.18%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.59%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 3 1 0 2 4 14 0 0 12 3 4 7 10 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 8 2 2 4 7 3 3 11 1 2 0 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 4 3 1 3 2 0 9 3 1 9 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 4 1 0 0 0 3 0 1 0 1 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 16 21 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 36 21 77
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 18 34 71
Total protein-coding genes (size: 11363 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 231 (6.1%)
Alanine (Ala, A)
n = 306 (8.09%)
Serine (Ser, S)
n = 282 (7.45%)
Threonine (Thr, T)
n = 314 (8.3%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 196 (5.18%)
Leucine (Leu, L)
n = 619 (16.36%)
Isoleucine (Ile, I)
n = 322 (8.51%)
Methionine (Met, M)
n = 176 (4.65%)
Proline (Pro, P)
n = 207 (5.47%)
Phenylalanine (Phe, F)
n = 233 (6.16%)
Tyrosine (Tyr, Y)
n = 106 (2.8%)
Tryptophan (Trp, W)
n = 114 (3.01%)
Aspartic acid (Asp, D)
n = 70 (1.85%)
Glutamic acid (Glu, E)
n = 96 (2.54%)
Asparagine (Asn, N)
n = 130 (3.44%)
Glutamine (Gln, Q)
n = 98 (2.59%)
Histidine (His, H)
n = 101 (2.67%)
Lysine (Lys, K)
n = 77 (2.03%)
Arginine (Arg, R)
n = 74 (1.96%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
185 137 127 131 118 160 55 120 81 17 61 50 58 27 139 94
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
49 8 19 48 149 99 10 35 76 80 40 43 51 98 15 52
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
99 146 17 55 63 92 15 20 37 48 58 10 35 49 81 25
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
76 55 41 17 53 69 8 16 16 38 4 1 0 5 0 104
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
899 944 1077 865
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
504 1052 683 1546
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
343 1177 1333 932

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.