Viewing data for Loxops coccineus


Scientific name Loxops coccineus
Common name Akepa
Maximum lifespan 10.00 years (Loxops coccineus@AnAge)

Total mtDNA (size: 15589 bases) GC AT G C A T
Base content (bases) 7152 8434 5000 2152 3714 4720
Base content per 1 kb (bases) 459 541 321 138 238 303
Base content (%) 45.9% 54.1%
Total protein-coding genes (size: 11379 bases) GC AT G C A T
Base content (bases) 5335 6041 3889 1446 2661 3380
Base content per 1 kb (bases) 469 531 342 127 234 297
Base content (%) 46.9% 53.1%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1472 bases) GC AT G C A T
Base content (bases) 605 867 353 252 381 486
Base content per 1 kb (bases) 411 589 240 171 259 330
Base content (%) 41.1% 58.9%
Total rRNA-coding genes (size: 1407 bases) GC AT G C A T
Base content (bases) 634 773 349 285 312 461
Base content per 1 kb (bases) 451 549 248 203 222 328
Base content (%) 45.1% 54.9%
12S rRNA gene (size: 346 bases) GC AT G C A T
Base content (bases) 159 187 83 76 82 105
Base content per 1 kb (bases) 460 540 240 220 237 303
Base content (%) 46.0% 54.0%
16S rRNA gene (size: 1061 bases) GC AT G C A T
Base content (bases) 475 586 266 209 230 356
Base content per 1 kb (bases) 448 552 251 197 217 336
Base content (%) 44.8% 55.2%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 306 378 234 72 171 207
Base content per 1 kb (bases) 447 553 342 105 250 303
Base content (%) 44.7% 55.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 76 92 64 12 43 49
Base content per 1 kb (bases) 452 548 381 71 256 292
Base content (%) 45.2% 54.8%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 749 801 497 252 370 431
Base content per 1 kb (bases) 483 516 320 162 239 278
Base content (%) 48.3% 51.6%
COX2 (size: 685 bases) GC AT G C A T
Base content (bases) 307 377 205 102 166 211
Base content per 1 kb (bases) 448 550 299 149 242 308
Base content (%) 44.8% 55.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 383 401 260 123 191 210
Base content per 1 kb (bases) 489 511 332 157 244 268
Base content (%) 48.9% 51.1%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 544 599 396 148 269 330
Base content per 1 kb (bases) 476 524 346 129 235 289
Base content (%) 47.6% 52.4%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 451 527 304 147 271 256
Base content per 1 kb (bases) 461 539 311 150 277 262
Base content (%) 46.1% 53.9%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 473 566 363 110 253 313
Base content per 1 kb (bases) 455 544 349 106 243 301
Base content (%) 45.5% 54.4%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 158 193 112 46 93 100
Base content per 1 kb (bases) 450 550 319 131 265 285
Base content (%) 45.0% 55.0%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 647 731 500 147 304 427
Base content per 1 kb (bases) 470 530 363 107 221 310
Base content (%) 47.0% 53.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 146 151 109 37 72 79
Base content per 1 kb (bases) 492 508 367 125 242 266
Base content (%) 49.2% 50.8%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 840 978 638 202 409 569
Base content per 1 kb (bases) 462 538 351 111 225 313
Base content (%) 46.2% 53.8%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 260 259 210 50 53 206
Base content per 1 kb (bases) 501 499 405 96 102 397
Base content (%) 50.1% 49.9%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 17 7 6 10 30 4 10 7 1 1 4 4 0 0 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 8 2 2 0 3 5 0 4 3 8 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 0 0 5 6 0 0 4 0 3 0 1 1 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 1 1 2 3 1 0 1 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 82 66 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 65 35 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 87 106 23
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFFIMIISWLTFSLIIQPKLLSFVSTNPPSNKPPIAPSTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 6 (10.91%)
Threonine (Thr, T)
n = 6 (10.91%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 6 (10.91%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 11 (20.0%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 0 0 3 1 1 0 2 0 0 0 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 1 0 0 0 0 0 5 2 4 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 1 0 0 2 3 0 0 1 0 0 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 18 20 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 24 8 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 22 21 10
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 41 (7.95%)
Leucine (Leu, L)
n = 64 (12.4%)
Isoleucine (Ile, I)
n = 37 (7.17%)
Methionine (Met, M)
n = 23 (4.46%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 29 18 9 12 40 1 2 7 2 5 16 17 3 4 39
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 6 24 15 0 5 11 28 2 4 9 16 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 16 0 1 12 11 0 0 4 2 15 0 0 1 14 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 10 0 1 14 9 0 1 2 5 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
157 129 126 104
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 137 94 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 231 211 58
COX2 (size: 685 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 23 (10.13%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 29 (12.78%)
Isoleucine (Ile, I)
n = 15 (6.61%)
Methionine (Met, M)
n = 13 (5.73%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 11 11 6 6 11 1 5 6 0 4 4 7 1 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 4 7 5 1 0 1 8 0 3 2 6 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 7 0 5 6 6 0 1 5 1 6 0 0 0 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 1 3 10 4 0 1 1 4 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 57 59 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 61 56 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 87 95 38
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 13 (5.0%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 10 4 2 8 17 3 3 9 0 2 7 8 0 3 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 10 10 0 1 8 10 1 3 6 4 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 8 0 5 5 4 0 0 4 0 10 1 0 0 4 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 0 0 5 4 0 1 1 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 72 53 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 70 54 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 118 103 32
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 29 (7.63%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 25 (6.58%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 23 (6.05%)
Leucine (Leu, L)
n = 62 (16.32%)
Isoleucine (Ile, I)
n = 35 (9.21%)
Methionine (Met, M)
n = 7 (1.84%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 26 6 3 18 37 3 1 8 0 2 6 15 0 2 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 3 17 7 2 1 9 13 1 6 7 9 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 14 0 3 9 9 0 0 1 0 12 0 0 3 18 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 0 0 8 10 0 1 3 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
91 113 99 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 99 79 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 184 152 36
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 31 (9.54%)
Serine (Ser, S)
n = 26 (8.0%)
Threonine (Thr, T)
n = 18 (5.54%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 16 (4.92%)
Leucine (Leu, L)
n = 68 (20.92%)
Isoleucine (Ile, I)
n = 22 (6.77%)
Methionine (Met, M)
n = 11 (3.38%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 17 (5.23%)
Tyrosine (Tyr, Y)
n = 16 (4.92%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 14 (4.31%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 12 8 13 10 26 9 9 4 2 0 4 8 4 6 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 5 12 11 3 2 5 5 1 5 11 8 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 7 1 4 8 8 0 2 4 4 12 2 1 4 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 6 1 3 7 0 2 1 4 1 1 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 98 79 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 93 60 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 113 117 63
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 25 (7.25%)
Serine (Ser, S)
n = 33 (9.57%)
Threonine (Thr, T)
n = 41 (11.88%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.61%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 32 (9.28%)
Methionine (Met, M)
n = 21 (6.09%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 19 16 7 23 21 7 8 9 1 0 7 2 0 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 4 9 9 3 1 4 4 3 5 7 9 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 11 1 3 11 12 1 0 6 0 7 1 0 1 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 1 0 1 12 2 0 2 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 102 126 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 114 58 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 145 128 47
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 25 (7.25%)
Serine (Ser, S)
n = 33 (9.57%)
Threonine (Thr, T)
n = 41 (11.88%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 9 (2.61%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 32 (9.28%)
Methionine (Met, M)
n = 21 (6.09%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 19 16 7 23 21 7 8 9 1 0 7 2 0 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 4 9 9 3 1 4 4 3 5 7 9 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 11 1 3 11 12 1 0 6 0 7 1 0 1 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 1 0 1 12 2 0 2 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 102 126 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 114 58 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 145 128 47
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 41 (8.95%)
Serine (Ser, S)
n = 36 (7.86%)
Threonine (Thr, T)
n = 43 (9.39%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 99 (21.62%)
Isoleucine (Ile, I)
n = 42 (9.17%)
Methionine (Met, M)
n = 25 (5.46%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 13 (2.84%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 17 (3.71%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 36 21 8 25 54 6 6 13 1 1 4 4 0 2 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 2 21 17 1 1 9 8 0 5 11 8 3 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 17 0 4 12 12 0 0 8 0 13 0 0 2 15 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 0 0 2 10 0 1 0 10 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 159 145 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 139 80 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 202 202 40
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 4 1 4 13 1 1 3 0 0 0 1 1 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 1 7 1 0 0 4 0 0 0 0 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 1 0 1 5 4 0 1 3 0 3 0 0 0 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 0 0 1 0 0 1 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 33 25 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 47 36 11
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 50 (8.26%)
Serine (Ser, S)
n = 54 (8.93%)
Threonine (Thr, T)
n = 66 (10.91%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 16 (2.64%)
Leucine (Leu, L)
n = 103 (17.02%)
Isoleucine (Ile, I)
n = 53 (8.76%)
Methionine (Met, M)
n = 29 (4.79%)
Proline (Pro, P)
n = 30 (4.96%)
Phenylalanine (Phe, F)
n = 35 (5.79%)
Tyrosine (Tyr, Y)
n = 12 (1.98%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 28 (4.63%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 21 (3.47%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 34 26 3 30 62 4 4 17 0 3 3 9 1 3 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 6 4 27 19 0 4 7 20 2 4 16 10 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
40 19 0 9 19 15 1 1 9 1 11 1 0 0 28 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 11 1 2 6 21 0 0 2 6 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
119 166 208 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 190 110 236
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 282 251 60
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (18.02%)
Alanine (Ala, A)
n = 13 (7.56%)
Serine (Ser, S)
n = 14 (8.14%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 32 (18.6%)
Leucine (Leu, L)
n = 31 (18.02%)
Isoleucine (Ile, I)
n = 3 (1.74%)
Methionine (Met, M)
n = 5 (2.91%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 10 (5.81%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 4 (2.33%)
Asparagine (Asn, N)
n = 3 (1.74%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 2 4 0 2 4 4 0 0 15 0 1 16 10 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 6 0 2 5 6 0 4 21 2 0 1 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 6 1 1 2 3 1 6 1 4 17 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 3 0 0 0 0 0 0 4 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 18 17 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 29 18 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
82 3 18 70
Total protein-coding genes (size: 11396 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 224 (5.9%)
Alanine (Ala, A)
n = 307 (8.09%)
Serine (Ser, S)
n = 297 (7.82%)
Threonine (Thr, T)
n = 312 (8.22%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 192 (5.06%)
Leucine (Leu, L)
n = 672 (17.7%)
Isoleucine (Ile, I)
n = 291 (7.67%)
Methionine (Met, M)
n = 161 (4.24%)
Proline (Pro, P)
n = 224 (5.9%)
Phenylalanine (Phe, F)
n = 217 (5.72%)
Tyrosine (Tyr, Y)
n = 109 (2.87%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 90 (2.37%)
Asparagine (Asn, N)
n = 137 (3.61%)
Glutamine (Gln, Q)
n = 95 (2.5%)
Histidine (His, H)
n = 101 (2.66%)
Lysine (Lys, K)
n = 86 (2.27%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
84 207 125 64 155 330 48 56 88 7 33 55 77 27 40 177
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
36 4 24 42 146 102 17 21 61 109 32 46 77 90 10 50
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
144 115 3 42 98 94 4 8 51 15 94 10 19 15 122 17
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
84 77 13 11 55 83 3 8 13 45 5 2 1 4 2 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
878 1087 1049 780
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
491 1080 690 1533
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
237 1563 1494 500

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.