Viewing data for Cercopithecus lhoesti


Scientific name Cercopithecus lhoesti
Common name L'hoest's monkey
Maximum lifespan 24.10 years (Cercopithecus lhoesti@AnAge)

Total mtDNA (size: 16518 bases) GC AT G C A T
Base content (bases) 6932 9586 4896 2036 4264 5322
Base content per 1 kb (bases) 420 580 296 123 258 322
Base content (%) 42.0% 58.0%
Total protein-coding genes (size: 11358 bases) GC AT G C A T
Base content (bases) 4751 6607 3514 1237 3031 3576
Base content per 1 kb (bases) 418 582 309 109 267 315
Base content (%) 41.8% 58.2%
D-loop (size: 1074 bases) GC AT G C A T
Base content (bases) 478 596 345 133 275 321
Base content per 1 kb (bases) 445 555 321 124 256 299
Base content (%) 44.5% 55.5%
Total tRNA-coding genes (size: 1491 bases) GC AT G C A T
Base content (bases) 591 900 363 228 384 516
Base content per 1 kb (bases) 396 604 243 153 258 346
Base content (%) 39.6% 60.4%
Total rRNA-coding genes (size: 2509 bases) GC AT G C A T
Base content (bases) 1068 1441 635 433 555 886
Base content per 1 kb (bases) 426 574 253 173 221 353
Base content (%) 42.6% 57.4%
12S rRNA gene (size: 951 bases) GC AT G C A T
Base content (bases) 428 523 255 173 204 319
Base content per 1 kb (bases) 450 550 268 182 215 335
Base content (%) 45.0% 55.0%
16S rRNA gene (size: 1558 bases) GC AT G C A T
Base content (bases) 640 918 380 260 351 567
Base content per 1 kb (bases) 411 589 244 167 225 364
Base content (%) 41.1% 58.9%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 279 402 221 58 176 226
Base content per 1 kb (bases) 410 590 325 85 258 332
Base content (%) 41.0% 59.0%
ATP8 (size: 207 bases) GC AT G C A T
Base content (bases) 75 132 65 10 46 86
Base content per 1 kb (bases) 362 638 314 48 222 415
Base content (%) 36.2% 63.8%
COX1 (size: 1569 bases) GC AT G C A T
Base content (bases) 661 908 408 253 484 424
Base content per 1 kb (bases) 421 579 260 161 308 270
Base content (%) 42.1% 57.9%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 289 395 199 90 176 219
Base content per 1 kb (bases) 423 577 291 132 257 320
Base content (%) 42.3% 57.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 349 435 243 106 219 216
Base content per 1 kb (bases) 445 555 310 135 279 276
Base content (%) 44.5% 55.5%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 485 656 361 124 314 342
Base content per 1 kb (bases) 425 575 316 109 275 300
Base content (%) 42.5% 57.5%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 412 543 306 106 256 287
Base content per 1 kb (bases) 431 569 320 111 268 301
Base content (%) 43.1% 56.9%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 439 603 353 86 255 348
Base content per 1 kb (bases) 421 579 339 83 245 334
Base content (%) 42.1% 57.9%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 138 208 107 31 93 115
Base content per 1 kb (bases) 399 601 309 90 269 332
Base content (%) 39.9% 60.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 553 825 430 123 380 445
Base content per 1 kb (bases) 401 599 312 89 276 323
Base content (%) 40.1% 59.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 121 176 90 31 88 88
Base content per 1 kb (bases) 407 593 303 104 296 296
Base content (%) 40.7% 59.3%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 755 1051 571 184 461 590
Base content per 1 kb (bases) 418 582 316 102 255 327
Base content (%) 41.8% 58.2%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 212 310 174 38 97 213
Base content per 1 kb (bases) 406 594 333 73 186 408
Base content (%) 40.6% 59.4%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.1%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 9 (3.98%)
Threonine (Thr, T)
n = 29 (12.83%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 50 (22.12%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 15 (6.64%)
Phenylalanine (Phe, F)
n = 7 (3.1%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 2 (0.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 14 (6.19%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 8 (3.54%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 3 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 17 10 3 7 33 1 4 8 1 3 1 4 1 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 5 6 5 0 2 2 3 0 2 7 6 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 0 2 3 1 0 0 3 0 3 0 2 6 8 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 0 4 1 0 2 1 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
35 79 88 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 66 43 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 76 95 48
ATP8 (size: 207 bases)
Amino acid sequence: MPQLDTSTWFTTIMAMLPALYLITQLKLLNTNFYQPPPQKNPNKQAPNNHWQLKWTKIYLPHSQLQQS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (4.41%)
Serine (Ser, S)
n = 3 (4.41%)
Threonine (Thr, T)
n = 7 (10.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 10 (14.71%)
Isoleucine (Ile, I)
n = 3 (4.41%)
Methionine (Met, M)
n = 3 (4.41%)
Proline (Pro, P)
n = 8 (11.76%)
Phenylalanine (Phe, F)
n = 2 (2.94%)
Tyrosine (Tyr, Y)
n = 3 (4.41%)
Tryptophan (Trp, W)
n = 3 (4.41%)
Aspartic acid (Asp, D)
n = 1 (1.47%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 6 (8.82%)
Glutamine (Gln, Q)
n = 9 (13.24%)
Histidine (His, H)
n = 2 (2.94%)
Lysine (Lys, K)
n = 5 (7.35%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 1 2 2 1 4 1 2 9 0 0 0 0 0 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 2 0 0 0 0 0 1 5 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 1 0 2 1 0 0 0 2 1 0 0 4 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 1 5 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 27 24 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 21 27 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 17 35 14
COX1 (size: 1569 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.2%)
Alanine (Ala, A)
n = 41 (7.85%)
Serine (Ser, S)
n = 36 (6.9%)
Threonine (Thr, T)
n = 33 (6.32%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 32 (6.13%)
Leucine (Leu, L)
n = 60 (11.49%)
Isoleucine (Ile, I)
n = 43 (8.24%)
Methionine (Met, M)
n = 32 (6.13%)
Proline (Pro, P)
n = 30 (5.75%)
Phenylalanine (Phe, F)
n = 41 (7.85%)
Tyrosine (Tyr, Y)
n = 21 (4.02%)
Tryptophan (Trp, W)
n = 16 (3.07%)
Aspartic acid (Asp, D)
n = 14 (2.68%)
Glutamic acid (Glu, E)
n = 11 (2.11%)
Asparagine (Asn, N)
n = 19 (3.64%)
Glutamine (Gln, Q)
n = 7 (1.34%)
Histidine (His, H)
n = 18 (3.45%)
Lysine (Lys, K)
n = 10 (1.92%)
Arginine (Arg, R)
n = 9 (1.72%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 20 28 8 10 19 4 16 7 0 11 7 13 1 17 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 14 15 12 0 11 12 20 5 8 14 6 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 13 2 6 14 8 2 3 3 14 7 1 3 9 10 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 3 5 9 10 0 2 3 4 0 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
146 105 143 129
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
80 134 101 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 169 180 147
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 12 (5.29%)
Serine (Ser, S)
n = 13 (5.73%)
Threonine (Thr, T)
n = 23 (10.13%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 30 (13.22%)
Isoleucine (Ile, I)
n = 21 (9.25%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 9 (3.96%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 5 (2.2%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 15 9 4 2 19 0 4 6 1 4 5 3 1 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 0 7 5 0 3 2 4 2 5 4 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 0 3 4 3 1 1 1 5 5 0 1 4 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 0 4 5 4 0 0 3 3 0 0 0 0 1 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 59 70 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 62 56 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 78 93 48
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 13 (5.0%)
Serine (Ser, S)
n = 22 (8.46%)
Threonine (Thr, T)
n = 28 (10.77%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 12 (4.62%)
Leucine (Leu, L)
n = 38 (14.62%)
Isoleucine (Ile, I)
n = 18 (6.92%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 20 (7.69%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 6 (2.31%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 12 6 4 7 16 2 8 8 0 1 7 3 1 5 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 3 7 3 0 4 6 8 0 3 5 3 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 3 5 4 7 0 1 5 5 7 1 1 3 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 5 1 2 1 3 0 1 1 2 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 71 68 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 68 55 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 104 93 52
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (5.8%)
Alanine (Ala, A)
n = 17 (4.49%)
Serine (Ser, S)
n = 33 (8.71%)
Threonine (Thr, T)
n = 35 (9.23%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 10 (2.64%)
Leucine (Leu, L)
n = 62 (16.36%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 16 (4.22%)
Proline (Pro, P)
n = 25 (6.6%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 3 (0.79%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 10 (2.64%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 25 15 10 15 29 2 5 9 0 2 3 5 0 6 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 3 0 2 3 12 0 5 10 4 3 2 9 13 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 14 0 3 10 12 0 3 5 6 8 2 1 4 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 3 0 3 6 10 0 1 3 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 108 126 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 102 71 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 151 145 74
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.47%)
Alanine (Ala, A)
n = 27 (8.52%)
Serine (Ser, S)
n = 25 (7.89%)
Threonine (Thr, T)
n = 33 (10.41%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 9 (2.84%)
Leucine (Leu, L)
n = 60 (18.93%)
Isoleucine (Ile, I)
n = 22 (6.94%)
Methionine (Met, M)
n = 18 (5.68%)
Proline (Pro, P)
n = 21 (6.62%)
Phenylalanine (Phe, F)
n = 19 (5.99%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 15 (4.73%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 7 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 16 14 7 17 26 2 7 6 0 4 3 1 1 6 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 8 9 9 1 1 5 4 1 6 10 5 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 19 0 2 7 11 1 1 3 5 6 0 1 4 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 2 1 2 7 0 0 2 5 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 89 99 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 102 56 128
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 115 132 58
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 13 (3.76%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 51 (14.74%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (1.16%)
Leucine (Leu, L)
n = 62 (17.92%)
Isoleucine (Ile, I)
n = 39 (11.27%)
Methionine (Met, M)
n = 28 (8.09%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 10 (2.89%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 21 (6.07%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 26 25 9 18 25 6 3 8 3 2 1 1 0 2 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 8 2 1 1 7 7 0 3 10 7 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 23 0 5 10 10 1 1 2 3 7 1 1 4 17 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 0 8 2 0 3 0 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 98 152 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 110 63 143
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 145 133 51
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 13 (3.76%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 51 (14.74%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (1.16%)
Leucine (Leu, L)
n = 62 (17.92%)
Isoleucine (Ile, I)
n = 39 (11.27%)
Methionine (Met, M)
n = 28 (8.09%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 10 (2.89%)
Tyrosine (Tyr, Y)
n = 10 (2.89%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 21 (6.07%)
Glutamine (Gln, Q)
n = 11 (3.18%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 26 25 9 18 25 6 3 8 3 2 1 1 0 2 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 8 2 1 1 7 7 0 3 10 7 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 23 0 5 10 10 1 1 2 3 7 1 1 4 17 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 0 8 2 0 3 0 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
37 98 152 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 110 63 143
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 145 133 51
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (3.49%)
Alanine (Ala, A)
n = 26 (5.68%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 51 (11.14%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 89 (19.43%)
Isoleucine (Ile, I)
n = 38 (8.3%)
Methionine (Met, M)
n = 38 (8.3%)
Proline (Pro, P)
n = 23 (5.02%)
Phenylalanine (Phe, F)
n = 19 (4.15%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 25 (5.46%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 8 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 28 33 17 24 30 1 16 10 0 2 1 6 0 10 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 2 15 8 1 3 7 5 1 7 9 7 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 22 1 10 10 9 0 2 7 3 12 0 1 11 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 1 0 3 12 1 2 1 5 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 127 174 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 129 88 193
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 174 183 90
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 9 (9.18%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 3 9 1 6 11 0 2 0 0 0 1 3 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 2 4 3 0 1 2 1 0 0 2 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 3 0 3 2 4 1 0 0 1 1 0 0 2 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 1 0 0 0 1 0 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 25 31 22
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 27 17 47
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 38 40 19
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.16%)
Alanine (Ala, A)
n = 45 (7.49%)
Serine (Ser, S)
n = 50 (8.32%)
Threonine (Thr, T)
n = 57 (9.48%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 12 (2.0%)
Leucine (Leu, L)
n = 98 (16.31%)
Isoleucine (Ile, I)
n = 55 (9.15%)
Methionine (Met, M)
n = 44 (7.32%)
Proline (Pro, P)
n = 31 (5.16%)
Phenylalanine (Phe, F)
n = 30 (4.99%)
Tyrosine (Tyr, Y)
n = 18 (3.0%)
Tryptophan (Trp, W)
n = 13 (2.16%)
Aspartic acid (Asp, D)
n = 12 (2.0%)
Glutamic acid (Glu, E)
n = 9 (1.5%)
Asparagine (Asn, N)
n = 32 (5.32%)
Glutamine (Gln, Q)
n = 19 (3.16%)
Histidine (His, H)
n = 15 (2.5%)
Lysine (Lys, K)
n = 23 (3.83%)
Arginine (Arg, R)
n = 8 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 35 42 18 25 43 4 7 17 2 2 3 6 1 5 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 5 9 23 13 0 3 11 10 1 4 9 17 1 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 21 2 9 14 13 0 2 12 8 10 2 1 6 26 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 0 6 6 23 0 2 3 3 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
103 163 225 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 169 129 239
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 239 236 111
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.18%)
Alanine (Ala, A)
n = 9 (5.2%)
Serine (Ser, S)
n = 13 (7.51%)
Threonine (Thr, T)
n = 7 (4.05%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 24 (13.87%)
Leucine (Leu, L)
n = 22 (12.72%)
Isoleucine (Ile, I)
n = 12 (6.94%)
Methionine (Met, M)
n = 10 (5.78%)
Proline (Pro, P)
n = 3 (1.73%)
Phenylalanine (Phe, F)
n = 10 (5.78%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 9 (5.2%)
Asparagine (Asn, N)
n = 4 (2.31%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 2 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 0 4 1 0 1 0 7 0 1 11 0 4 9 10 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 5 0 3 1 13 1 2 12 3 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 1 5 0 0 2 5 1 8 1 2 13 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 8 2 0 0 1 0 0 1 1 0 1 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 8 41 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 26 26 78
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
58 4 30 82
Total protein-coding genes (size: 11412 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 207 (5.45%)
Alanine (Ala, A)
n = 238 (6.26%)
Serine (Ser, S)
n = 287 (7.55%)
Threonine (Thr, T)
n = 371 (9.76%)
Cysteine (Cys, C)
n = 22 (0.58%)
Valine (Val, V)
n = 139 (3.66%)
Leucine (Leu, L)
n = 627 (16.5%)
Isoleucine (Ile, I)
n = 340 (8.95%)
Methionine (Met, M)
n = 234 (6.16%)
Proline (Pro, P)
n = 212 (5.58%)
Phenylalanine (Phe, F)
n = 204 (5.37%)
Tyrosine (Tyr, Y)
n = 131 (3.45%)
Tryptophan (Trp, W)
n = 103 (2.71%)
Aspartic acid (Asp, D)
n = 60 (1.58%)
Glutamic acid (Glu, E)
n = 84 (2.21%)
Asparagine (Asn, N)
n = 178 (4.68%)
Glutamine (Gln, Q)
n = 99 (2.6%)
Histidine (His, H)
n = 103 (2.71%)
Lysine (Lys, K)
n = 95 (2.5%)
Arginine (Arg, R)
n = 61 (1.6%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
133 207 201 84 138 273 24 83 91 8 42 32 50 15 73 131
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
33 6 16 54 101 79 4 47 66 68 26 45 86 77 4 64
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
138 159 10 54 82 81 8 19 43 62 69 11 25 64 114 32
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
71 69 15 24 36 90 5 9 22 28 2 0 1 5 1 92
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
728 994 1281 799
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
456 1046 756 1544
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
192 1352 1446 812

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.