Viewing data for Plecoglossus altivelis


Scientific name Plecoglossus altivelis
Common name Ayu
Maximum lifespan 3.00 years (Plecoglossus altivelis@AnAge)

Total mtDNA (size: 16542 bases) GC AT G C A T
Base content (bases) 8377 8165 5120 3257 4304 3861
Base content per 1 kb (bases) 506 494 310 197 260 233
Base content (%) 50.6% 49.4%
Total protein-coding genes (size: 11413 bases) GC AT G C A T
Base content (bases) 5918 5495 3790 2128 3117 2378
Base content per 1 kb (bases) 519 481 332 186 273 208
Base content (%) 51.9% 48.1%
D-loop (size: 857 bases) GC AT G C A T
Base content (bases) 351 506 204 147 252 254
Base content per 1 kb (bases) 410 590 238 172 294 296
Base content (%) 41.0% 59.0%
Total tRNA-coding genes (size: 1557 bases) GC AT G C A T
Base content (bases) 741 816 403 338 370 446
Base content per 1 kb (bases) 476 524 259 217 238 286
Base content (%) 47.6% 52.4%
Total rRNA-coding genes (size: 2658 bases) GC AT G C A T
Base content (bases) 1329 1329 701 628 557 772
Base content per 1 kb (bases) 500 500 264 236 210 290
Base content (%) 50.0% 50.0%
12S rRNA gene (size: 945 bases) GC AT G C A T
Base content (bases) 481 464 254 227 202 262
Base content per 1 kb (bases) 509 491 269 240 214 277
Base content (%) 50.9% 49.1%
16S rRNA gene (size: 1713 bases) GC AT G C A T
Base content (bases) 848 865 447 401 355 510
Base content per 1 kb (bases) 495 505 261 234 207 298
Base content (%) 49.5% 50.5%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 354 330 247 107 189 141
Base content per 1 kb (bases) 518 482 361 156 276 206
Base content (%) 51.8% 48.2%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 78 90 55 23 45 45
Base content per 1 kb (bases) 464 536 327 137 268 268
Base content (%) 46.4% 53.6%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 768 783 467 301 439 344
Base content per 1 kb (bases) 495 505 301 194 283 222
Base content (%) 49.5% 50.5%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 350 341 221 129 173 168
Base content per 1 kb (bases) 507 493 320 187 250 243
Base content (%) 50.7% 49.3%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 407 379 249 158 217 162
Base content per 1 kb (bases) 518 482 317 201 276 206
Base content (%) 51.8% 48.2%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 577 564 368 209 339 225
Base content per 1 kb (bases) 506 494 323 183 297 197
Base content (%) 50.6% 49.4%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 516 459 327 189 289 170
Base content per 1 kb (bases) 529 471 335 194 296 174
Base content (%) 52.9% 47.1%
ND2 (size: 1051 bases) GC AT G C A T
Base content (bases) 568 483 377 191 297 186
Base content per 1 kb (bases) 540 460 359 182 283 177
Base content (%) 54.0% 46.0%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 183 166 111 72 112 54
Base content per 1 kb (bases) 524 476 318 206 321 155
Base content (%) 52.4% 47.6%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 727 654 456 271 364 290
Base content per 1 kb (bases) 526 474 330 196 264 210
Base content (%) 52.6% 47.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 166 131 112 54 78 53
Base content per 1 kb (bases) 559 441 377 182 263 178
Base content (%) 55.9% 44.1%
ND5 (size: 1839 bases) GC AT G C A T
Base content (bases) 926 913 602 324 515 398
Base content per 1 kb (bases) 504 496 327 176 280 216
Base content (%) 50.4% 49.6%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 304 218 202 102 65 153
Base content per 1 kb (bases) 582 418 387 195 125 293
Base content (%) 58.2% 41.8%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 19 (8.37%)
Serine (Ser, S)
n = 8 (3.52%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 54 (23.79%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 13 (5.73%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 9 4 14 18 10 7 4 6 3 5 6 4 1 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 3 13 2 1 1 7 1 2 6 9 2 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 7 3 0 2 2 0 0 4 0 3 2 1 1 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 1 3 0 1 0 1 0 4 1 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 84 62 31
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 62 31 109
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 101 48 49
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFAILVFSWLVFLTVIPPKVLGHVFSNEPTVQSAEKTNPESWNWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 3 (5.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (10.91%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 2 0 1 2 1 1 0 2 0 3 2 1 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 1 0 0 0 0 1 0 4 2 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 2 1 0 0 0 1 0 0 0 0 0 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 1 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
13 17 13 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 17 14 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 21 18 14
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.91%)
Alanine (Ala, A)
n = 48 (9.3%)
Serine (Ser, S)
n = 30 (5.81%)
Threonine (Thr, T)
n = 35 (6.78%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.56%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 42 (8.14%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 27 6 20 13 16 11 2 3 5 14 8 10 7 13 29
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
18 0 1 16 20 10 2 5 13 13 15 10 10 8 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 10 2 6 13 5 1 1 4 4 14 2 1 4 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
19 11 0 3 11 7 1 2 1 4 1 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
158 123 129 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 136 94 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
66 208 121 122
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 18 (7.86%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 8 (3.49%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 20 (8.73%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 20 (8.73%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 5 (2.18%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 13 5 8 10 6 2 2 6 2 3 11 3 3 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 2 4 7 5 2 1 2 2 4 3 9 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 1 5 7 0 1 0 3 3 6 2 0 0 5 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 9 5 1 12 5 0 1 2 2 1 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 64 53 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 53 64 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 104 51 45
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (8.43%)
Alanine (Ala, A)
n = 21 (8.05%)
Serine (Ser, S)
n = 13 (4.98%)
Threonine (Thr, T)
n = 24 (9.2%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 19 (7.28%)
Leucine (Leu, L)
n = 31 (11.88%)
Isoleucine (Ile, I)
n = 14 (5.36%)
Methionine (Met, M)
n = 7 (2.68%)
Proline (Pro, P)
n = 12 (4.6%)
Phenylalanine (Phe, F)
n = 25 (9.58%)
Tyrosine (Tyr, Y)
n = 11 (4.21%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.83%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 8 (3.07%)
Histidine (His, H)
n = 17 (6.51%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 8 3 9 14 2 3 2 5 3 6 5 5 3 8 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 5 7 6 3 1 9 5 7 2 7 2 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 4 2 4 2 4 0 1 2 4 7 1 1 0 1 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 4 6 1 4 0 2 0 2 2 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 70 51 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 67 55 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 112 56 57
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 31 (8.18%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 19 (5.01%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 29 (7.65%)
Leucine (Leu, L)
n = 62 (16.36%)
Isoleucine (Ile, I)
n = 29 (7.65%)
Methionine (Met, M)
n = 10 (2.64%)
Proline (Pro, P)
n = 20 (5.28%)
Phenylalanine (Phe, F)
n = 32 (8.44%)
Tyrosine (Tyr, Y)
n = 12 (3.17%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 5 (1.32%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 17 2 24 15 9 8 6 2 3 6 17 3 3 8 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 2 10 16 3 2 4 10 5 7 6 10 2 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 5 2 6 7 7 2 1 1 2 10 3 0 0 17 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 3 4 1 10 5 5 2 0 2 4 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
104 101 87 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 92 74 162
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 175 64 88
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 35 (10.8%)
Serine (Ser, S)
n = 22 (6.79%)
Threonine (Thr, T)
n = 19 (5.86%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 22 (6.79%)
Leucine (Leu, L)
n = 63 (19.44%)
Isoleucine (Ile, I)
n = 22 (6.79%)
Methionine (Met, M)
n = 8 (2.47%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 18 (5.56%)
Tyrosine (Tyr, Y)
n = 12 (3.7%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 11 (3.4%)
Glutamine (Gln, Q)
n = 7 (2.16%)
Histidine (His, H)
n = 4 (1.23%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 11 0 19 20 7 6 6 1 6 6 8 3 5 12 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 10 16 5 4 3 7 2 6 7 13 4 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 0 0 6 9 3 0 1 3 1 11 4 5 4 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 2 9 0 4 2 5 2 2 2 2 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
90 95 71 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 96 57 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
60 136 42 87
ND2 (size: 1051 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (6.02%)
Alanine (Ala, A)
n = 48 (13.75%)
Serine (Ser, S)
n = 36 (10.32%)
Threonine (Thr, T)
n = 35 (10.03%)
Cysteine (Cys, C)
n = 2 (0.57%)
Valine (Val, V)
n = 10 (2.87%)
Leucine (Leu, L)
n = 66 (18.91%)
Isoleucine (Ile, I)
n = 25 (7.16%)
Methionine (Met, M)
n = 13 (3.72%)
Proline (Pro, P)
n = 18 (5.16%)
Phenylalanine (Phe, F)
n = 14 (4.01%)
Tyrosine (Tyr, Y)
n = 6 (1.72%)
Tryptophan (Trp, W)
n = 12 (3.44%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 8 (2.29%)
Glutamine (Gln, Q)
n = 12 (3.44%)
Histidine (His, H)
n = 6 (1.72%)
Lysine (Lys, K)
n = 9 (2.58%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 14 4 22 20 8 9 4 6 6 3 5 2 0 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 2 17 22 3 6 2 11 2 6 8 8 1 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 6 1 5 20 6 1 1 3 1 5 10 3 3 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 1 3 1 0 1 8 0 3 0 1 0 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 99 94 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 133 46 128
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
64 145 46 95
ND3 (size: 1051 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (6.02%)
Alanine (Ala, A)
n = 48 (13.75%)
Serine (Ser, S)
n = 36 (10.32%)
Threonine (Thr, T)
n = 35 (10.03%)
Cysteine (Cys, C)
n = 2 (0.57%)
Valine (Val, V)
n = 10 (2.87%)
Leucine (Leu, L)
n = 66 (18.91%)
Isoleucine (Ile, I)
n = 25 (7.16%)
Methionine (Met, M)
n = 13 (3.72%)
Proline (Pro, P)
n = 18 (5.16%)
Phenylalanine (Phe, F)
n = 14 (4.01%)
Tyrosine (Tyr, Y)
n = 6 (1.72%)
Tryptophan (Trp, W)
n = 12 (3.44%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 8 (2.29%)
Glutamine (Gln, Q)
n = 12 (3.44%)
Histidine (His, H)
n = 6 (1.72%)
Lysine (Lys, K)
n = 9 (2.58%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 14 4 22 20 8 9 4 6 6 3 5 2 0 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 2 17 22 3 6 2 11 2 6 8 8 1 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 6 1 5 20 6 1 1 3 1 5 10 3 3 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 1 3 1 0 1 8 0 3 0 1 0 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 99 94 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 133 46 128
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
64 145 46 95
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (5.88%)
Alanine (Ala, A)
n = 44 (9.59%)
Serine (Ser, S)
n = 31 (6.75%)
Threonine (Thr, T)
n = 37 (8.06%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 20 (4.36%)
Leucine (Leu, L)
n = 93 (20.26%)
Isoleucine (Ile, I)
n = 34 (7.41%)
Methionine (Met, M)
n = 22 (4.79%)
Proline (Pro, P)
n = 27 (5.88%)
Phenylalanine (Phe, F)
n = 15 (3.27%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 11 (2.4%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 9 (1.96%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 18 5 25 26 16 14 4 4 8 3 9 4 4 6 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
17 2 3 7 19 15 3 4 10 5 8 6 15 5 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 9 3 7 10 3 3 2 6 2 12 10 8 1 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 6 0 5 4 5 1 3 5 2 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
108 142 121 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 131 74 184
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
92 183 95 90
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 15 (15.31%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 21 (21.43%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 1 (1.02%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (4.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 1 4 9 4 3 0 2 0 0 0 1 0 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 5 9 1 0 0 3 2 1 1 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 1 4 1 1 2 1 0 1 0 1 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 1 0 0 0 1 2 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
26 32 21 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 32 13 37
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 48 19 21
ND5 (size: 1839 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.07%)
Alanine (Ala, A)
n = 63 (10.29%)
Serine (Ser, S)
n = 52 (8.5%)
Threonine (Thr, T)
n = 51 (8.33%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 29 (4.74%)
Leucine (Leu, L)
n = 100 (16.34%)
Isoleucine (Ile, I)
n = 43 (7.03%)
Methionine (Met, M)
n = 26 (4.25%)
Proline (Pro, P)
n = 29 (4.74%)
Phenylalanine (Phe, F)
n = 42 (6.86%)
Tyrosine (Tyr, Y)
n = 12 (1.96%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 12 (1.96%)
Glutamic acid (Glu, E)
n = 12 (1.96%)
Asparagine (Asn, N)
n = 27 (4.41%)
Glutamine (Gln, Q)
n = 19 (3.1%)
Histidine (His, H)
n = 15 (2.45%)
Lysine (Lys, K)
n = 20 (3.27%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 25 7 25 41 15 6 5 10 9 13 9 4 3 20 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
19 2 4 16 32 10 5 5 13 3 10 10 13 3 3 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 10 2 10 14 8 4 2 14 0 12 9 8 4 23 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 4 8 7 5 8 12 0 2 4 3 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
147 159 183 124
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 179 118 240
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
101 264 97 151
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (15.03%)
Alanine (Ala, A)
n = 19 (10.98%)
Serine (Ser, S)
n = 13 (7.51%)
Threonine (Thr, T)
n = 6 (3.47%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 30 (17.34%)
Leucine (Leu, L)
n = 29 (16.76%)
Isoleucine (Ile, I)
n = 3 (1.73%)
Methionine (Met, M)
n = 3 (1.73%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 9 (5.2%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 6 (3.47%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 0 3 1 6 8 4 0 0 5 3 5 17 6 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 4 5 5 5 1 4 3 18 0 1 0 3 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 0 4 3 2 2 0 2 2 6 4 7 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 6 1 2 0 1 0 0 1 4 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 27 17 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 40 21 74
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
79 35 27 33
Total protein-coding genes (size: 11435 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 250 (6.56%)
Alanine (Ala, A)
n = 376 (9.87%)
Serine (Ser, S)
n = 266 (6.98%)
Threonine (Thr, T)
n = 272 (7.14%)
Cysteine (Cys, C)
n = 28 (0.74%)
Valine (Val, V)
n = 248 (6.51%)
Leucine (Leu, L)
n = 641 (16.83%)
Isoleucine (Ile, I)
n = 264 (6.93%)
Methionine (Met, M)
n = 141 (3.7%)
Proline (Pro, P)
n = 211 (5.54%)
Phenylalanine (Phe, F)
n = 237 (6.22%)
Tyrosine (Tyr, Y)
n = 108 (2.84%)
Tryptophan (Trp, W)
n = 121 (3.18%)
Aspartic acid (Asp, D)
n = 74 (1.94%)
Glutamic acid (Glu, E)
n = 103 (2.7%)
Asparagine (Asn, N)
n = 113 (2.97%)
Glutamine (Gln, Q)
n = 95 (2.49%)
Histidine (His, H)
n = 103 (2.7%)
Lysine (Lys, K)
n = 75 (1.97%)
Arginine (Arg, R)
n = 76 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
112 152 37 180 198 103 81 40 49 46 67 87 47 47 93 144
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
104 8 20 104 174 65 33 27 93 45 85 65 101 32 13 71
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
128 56 17 58 93 43 17 11 44 21 87 49 39 19 94 19
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
84 47 56 18 56 34 41 9 22 25 20 0 0 7 1 72
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1051 1047 920 792
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
530 1070 679 1531
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
649 1577 702 882

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.