Viewing data for Callithrix pygmaea


Scientific name Callithrix pygmaea
Common name Pygmy marmoset
Maximum lifespan 18.60 years (Callithrix pygmaea@AnAge)

Total mtDNA (size: 16520 bases) GC AT G C A T
Base content (bases) 6555 9965 4377 2178 4502 5463
Base content per 1 kb (bases) 397 603 265 132 273 331
Base content (%) 39.7% 60.3%
Total protein-coding genes (size: 11352 bases) GC AT G C A T
Base content (bases) 4535 6817 3207 1328 3144 3673
Base content per 1 kb (bases) 399 601 283 117 277 324
Base content (%) 39.9% 60.1%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1503 bases) GC AT G C A T
Base content (bases) 538 965 308 230 433 532
Base content per 1 kb (bases) 358 642 205 153 288 354
Base content (%) 35.8% 64.2%
Total rRNA-coding genes (size: 2503 bases) GC AT G C A T
Base content (bases) 1009 1494 563 446 614 880
Base content per 1 kb (bases) 403 597 225 178 245 352
Base content (%) 40.3% 59.7%
12S rRNA gene (size: 946 bases) GC AT G C A T
Base content (bases) 404 542 221 183 222 320
Base content per 1 kb (bases) 427 573 234 193 235 338
Base content (%) 42.7% 57.3%
16S rRNA gene (size: 1557 bases) GC AT G C A T
Base content (bases) 605 952 342 263 392 560
Base content per 1 kb (bases) 389 611 220 169 252 360
Base content (%) 38.9% 61.1%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 266 415 200 66 195 220
Base content per 1 kb (bases) 391 609 294 97 286 323
Base content (%) 39.1% 60.9%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 63 138 48 15 57 81
Base content per 1 kb (bases) 313 687 239 75 284 403
Base content (%) 31.3% 68.7%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 661 896 404 257 455 441
Base content per 1 kb (bases) 425 575 259 165 292 283
Base content (%) 42.5% 57.5%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 278 410 179 99 193 217
Base content per 1 kb (bases) 404 596 260 144 281 315
Base content (%) 40.4% 59.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 351 433 235 116 210 223
Base content per 1 kb (bases) 448 552 300 148 268 284
Base content (%) 44.8% 55.2%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 486 654 350 136 308 346
Base content per 1 kb (bases) 426 574 307 119 270 304
Base content (%) 42.6% 57.4%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 385 571 278 107 267 304
Base content per 1 kb (bases) 403 597 291 112 279 318
Base content (%) 40.3% 59.7%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 393 646 307 86 264 382
Base content per 1 kb (bases) 378 622 295 83 254 368
Base content (%) 37.8% 62.2%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 140 206 102 38 98 108
Base content per 1 kb (bases) 405 595 295 110 283 312
Base content (%) 40.5% 59.5%
ND4 (size: 1375 bases) GC AT G C A T
Base content (bases) 515 860 384 131 401 459
Base content per 1 kb (bases) 375 625 279 95 292 334
Base content (%) 37.5% 62.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 103 194 71 32 99 95
Base content per 1 kb (bases) 347 653 239 108 333 320
Base content (%) 34.7% 65.3%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 706 1100 513 193 498 602
Base content per 1 kb (bases) 391 609 284 107 276 333
Base content (%) 39.1% 60.9%
ND6 (size: 534 bases) GC AT G C A T
Base content (bases) 206 328 149 57 114 214
Base content per 1 kb (bases) 386 614 279 107 213 401
Base content (%) 38.6% 61.4%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 15 (6.64%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 45 (19.91%)
Isoleucine (Ile, I)
n = 28 (12.39%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 9 (3.98%)
Tyrosine (Tyr, Y)
n = 5 (2.21%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 3 (1.33%)
Glutamic acid (Glu, E)
n = 2 (0.88%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 5 (2.21%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 14 10 5 10 20 2 7 9 0 1 2 5 2 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 4 7 0 4 0 4 1 1 6 4 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 14 0 1 8 4 0 0 2 3 2 0 1 5 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 3 4 0 1 0 3 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 67 82 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
18 64 41 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 69 97 52
ATP8 (size: 201 bases)
Amino acid sequence: VPQLNISPWPMVILSMIVTLFYIIQLKVLNFTFHTTPSLKLTKTQKHKTTWELKWTKIYSPPSTSR*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 6 (9.09%)
Threonine (Thr, T)
n = 10 (15.15%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (6.06%)
Leucine (Leu, L)
n = 8 (12.12%)
Isoleucine (Ile, I)
n = 6 (9.09%)
Methionine (Met, M)
n = 2 (3.03%)
Proline (Pro, P)
n = 6 (9.09%)
Phenylalanine (Phe, F)
n = 3 (4.55%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.52%)
Asparagine (Asn, N)
n = 2 (3.03%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 2 (3.03%)
Lysine (Lys, K)
n = 7 (10.61%)
Arginine (Arg, R)
n = 1 (1.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 1 0 0 6 0 2 2 1 0 0 2 2 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 1 3 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 0 0 1 3 2 0 0 2 0 0 0 1 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 0 7 0 0 0 1 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 18 27 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 22 18 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 8 36 17
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.88%)
Alanine (Ala, A)
n = 38 (7.34%)
Serine (Ser, S)
n = 35 (6.76%)
Threonine (Thr, T)
n = 38 (7.34%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.56%)
Leucine (Leu, L)
n = 61 (11.78%)
Isoleucine (Ile, I)
n = 41 (7.92%)
Methionine (Met, M)
n = 30 (5.79%)
Proline (Pro, P)
n = 28 (5.41%)
Phenylalanine (Phe, F)
n = 41 (7.92%)
Tyrosine (Tyr, Y)
n = 20 (3.86%)
Tryptophan (Trp, W)
n = 16 (3.09%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 11 (2.12%)
Asparagine (Asn, N)
n = 18 (3.47%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 19 (3.67%)
Lysine (Lys, K)
n = 11 (2.12%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 19 24 6 10 27 5 12 5 2 7 6 18 3 15 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 11 8 19 0 6 17 14 9 8 7 11 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 14 3 6 10 14 1 0 4 9 11 2 1 10 8 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 1 8 7 10 1 1 2 5 0 0 1 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
144 110 143 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 101 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 159 197 126
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 18 (7.89%)
Serine (Ser, S)
n = 18 (7.89%)
Threonine (Thr, T)
n = 12 (5.26%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.82%)
Leucine (Leu, L)
n = 29 (12.72%)
Isoleucine (Ile, I)
n = 22 (9.65%)
Methionine (Met, M)
n = 14 (6.14%)
Proline (Pro, P)
n = 12 (5.26%)
Phenylalanine (Phe, F)
n = 10 (4.39%)
Tyrosine (Tyr, Y)
n = 14 (6.14%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 10 (4.39%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 6 (2.63%)
Glutamine (Gln, Q)
n = 8 (3.51%)
Histidine (His, H)
n = 6 (2.63%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 11 11 4 4 11 2 6 6 2 3 0 7 1 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 7 4 6 1 2 2 3 1 0 5 6 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 4 0 3 4 7 0 1 3 6 8 0 2 3 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 14 0 3 7 4 0 0 3 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 53 62 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 56 62 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 70 93 53
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 19 (7.31%)
Serine (Ser, S)
n = 22 (8.46%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 11 (4.23%)
Leucine (Leu, L)
n = 25 (9.62%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 13 (5.0%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 14 (5.38%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 10 8 5 3 14 2 1 9 0 3 1 7 0 6 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 3 8 8 0 2 8 10 0 4 3 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 3 4 7 6 0 0 5 7 7 0 0 2 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 2 1 2 2 0 0 1 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 66 64 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 72 56 90
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 97 103 49
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.07%)
Alanine (Ala, A)
n = 24 (6.33%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 38 (10.03%)
Cysteine (Cys, C)
n = 2 (0.53%)
Valine (Val, V)
n = 11 (2.9%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 25 (6.6%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 13 (3.43%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 11 (2.9%)
Arginine (Arg, R)
n = 7 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 22 13 9 8 30 4 5 8 0 1 6 4 0 11 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 6 8 10 0 3 10 8 2 2 9 13 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 21 0 4 9 8 1 2 1 3 10 2 0 5 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 0 3 8 9 2 1 0 6 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 103 119 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 109 75 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 138 152 76
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 21 (6.62%)
Threonine (Thr, T)
n = 32 (10.09%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 8 (2.52%)
Leucine (Leu, L)
n = 59 (18.61%)
Isoleucine (Ile, I)
n = 24 (7.57%)
Methionine (Met, M)
n = 22 (6.94%)
Proline (Pro, P)
n = 20 (6.31%)
Phenylalanine (Phe, F)
n = 18 (5.68%)
Tyrosine (Tyr, Y)
n = 15 (4.73%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 14 (4.42%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 1 (0.32%)
Lysine (Lys, K)
n = 6 (1.89%)
Arginine (Arg, R)
n = 7 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 11 17 5 10 30 2 11 7 0 1 1 5 1 8 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 2 14 12 0 2 7 3 0 7 5 7 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 13 1 2 5 12 0 0 2 10 5 2 1 4 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 11 0 1 2 5 1 0 1 6 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 82 100 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 99 57 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 97 146 61
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 17 (4.93%)
Serine (Ser, S)
n = 27 (7.83%)
Threonine (Thr, T)
n = 38 (11.01%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 58 (16.81%)
Isoleucine (Ile, I)
n = 37 (10.72%)
Methionine (Met, M)
n = 35 (10.14%)
Proline (Pro, P)
n = 25 (7.25%)
Phenylalanine (Phe, F)
n = 13 (3.77%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 22 (6.38%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 8 (2.32%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 19 27 5 8 35 1 6 10 0 0 2 5 0 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 0 3 10 4 0 0 4 7 1 3 8 14 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 24 1 1 8 13 1 1 3 5 3 0 3 4 18 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 0 0 0 10 1 0 1 2 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 95 147 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 103 63 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 109 172 49
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 17 (4.93%)
Serine (Ser, S)
n = 27 (7.83%)
Threonine (Thr, T)
n = 38 (11.01%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 58 (16.81%)
Isoleucine (Ile, I)
n = 37 (10.72%)
Methionine (Met, M)
n = 35 (10.14%)
Proline (Pro, P)
n = 25 (7.25%)
Phenylalanine (Phe, F)
n = 13 (3.77%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 22 (6.38%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 8 (2.32%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 19 27 5 8 35 1 6 10 0 0 2 5 0 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 0 3 10 4 0 0 4 7 1 3 8 14 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 24 1 1 8 13 1 1 3 5 3 0 3 4 18 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 0 0 0 10 1 0 1 2 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 95 147 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 103 63 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 109 172 49
ND4 (size: 1375 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.72%)
Alanine (Ala, A)
n = 26 (5.69%)
Serine (Ser, S)
n = 38 (8.32%)
Threonine (Thr, T)
n = 44 (9.63%)
Cysteine (Cys, C)
n = 7 (1.53%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 91 (19.91%)
Isoleucine (Ile, I)
n = 44 (9.63%)
Methionine (Met, M)
n = 38 (8.32%)
Proline (Pro, P)
n = 26 (5.69%)
Phenylalanine (Phe, F)
n = 20 (4.38%)
Tyrosine (Tyr, Y)
n = 16 (3.5%)
Tryptophan (Trp, W)
n = 11 (2.41%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 22 (4.81%)
Glutamine (Gln, Q)
n = 8 (1.75%)
Histidine (His, H)
n = 8 (1.75%)
Lysine (Lys, K)
n = 12 (2.63%)
Arginine (Arg, R)
n = 10 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 18 34 13 8 50 3 15 8 0 3 2 4 0 7 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 5 5 11 10 0 5 4 7 1 6 9 11 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 22 1 4 11 12 0 5 6 9 7 1 2 5 17 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 9 0 1 1 12 0 1 2 7 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 126 171 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
56 123 77 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 135 211 100
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 25 (25.51%)
Isoleucine (Ile, I)
n = 8 (8.16%)
Methionine (Met, M)
n = 11 (11.22%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 6 (6.12%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 5 8 2 1 14 1 6 2 0 0 0 3 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 2 2 3 0 0 3 1 0 1 0 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 0 1 2 2 2 0 0 4 2 0 1 2 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
17 25 29 28
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 21 19 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 25 47 20
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (4.33%)
Alanine (Ala, A)
n = 36 (5.99%)
Serine (Ser, S)
n = 57 (9.48%)
Threonine (Thr, T)
n = 60 (9.98%)
Cysteine (Cys, C)
n = 3 (0.5%)
Valine (Val, V)
n = 17 (2.83%)
Leucine (Leu, L)
n = 90 (14.98%)
Isoleucine (Ile, I)
n = 55 (9.15%)
Methionine (Met, M)
n = 43 (7.15%)
Proline (Pro, P)
n = 30 (4.99%)
Phenylalanine (Phe, F)
n = 43 (7.15%)
Tyrosine (Tyr, Y)
n = 17 (2.83%)
Tryptophan (Trp, W)
n = 13 (2.16%)
Aspartic acid (Asp, D)
n = 10 (1.66%)
Glutamic acid (Glu, E)
n = 11 (1.83%)
Asparagine (Asn, N)
n = 32 (5.32%)
Glutamine (Gln, Q)
n = 18 (3.0%)
Histidine (His, H)
n = 13 (2.16%)
Lysine (Lys, K)
n = 19 (3.16%)
Arginine (Arg, R)
n = 8 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 32 37 13 9 43 7 18 17 1 4 2 11 0 18 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 3 3 16 16 1 4 8 10 4 6 7 17 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 26 2 7 13 21 1 2 13 4 13 5 0 12 20 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 0 0 10 18 1 2 3 3 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
100 141 224 137
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 168 121 248
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 204 257 113
ND6 (size: 534 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.12%)
Alanine (Ala, A)
n = 12 (6.78%)
Serine (Ser, S)
n = 11 (6.21%)
Threonine (Thr, T)
n = 11 (6.21%)
Cysteine (Cys, C)
n = 2 (1.13%)
Valine (Val, V)
n = 17 (9.6%)
Leucine (Leu, L)
n = 18 (10.17%)
Isoleucine (Ile, I)
n = 14 (7.91%)
Methionine (Met, M)
n = 14 (7.91%)
Proline (Pro, P)
n = 6 (3.39%)
Phenylalanine (Phe, F)
n = 12 (6.78%)
Tyrosine (Tyr, Y)
n = 10 (5.65%)
Tryptophan (Trp, W)
n = 4 (2.26%)
Aspartic acid (Asp, D)
n = 5 (2.82%)
Glutamic acid (Glu, E)
n = 7 (3.95%)
Asparagine (Asn, N)
n = 3 (1.69%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.13%)
Lysine (Lys, K)
n = 2 (1.13%)
Arginine (Arg, R)
n = 2 (1.13%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 1 7 1 0 2 2 8 0 0 6 0 4 7 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 0 6 1 3 2 13 1 1 10 4 1 0 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 4 4 0 2 1 4 0 10 0 2 5 2 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 5 5 0 2 0 2 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 15 48 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 36 30 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 6 36 90
Total protein-coding genes (size: 11404 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 205 (5.4%)
Alanine (Ala, A)
n = 248 (6.53%)
Serine (Ser, S)
n = 285 (7.5%)
Threonine (Thr, T)
n = 352 (9.27%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 144 (3.79%)
Leucine (Leu, L)
n = 592 (15.59%)
Isoleucine (Ile, I)
n = 344 (9.06%)
Methionine (Met, M)
n = 251 (6.61%)
Proline (Pro, P)
n = 210 (5.53%)
Phenylalanine (Phe, F)
n = 234 (6.16%)
Tyrosine (Tyr, Y)
n = 143 (3.77%)
Tryptophan (Trp, W)
n = 103 (2.71%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 91 (2.4%)
Asparagine (Asn, N)
n = 159 (4.19%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 96 (2.53%)
Lysine (Lys, K)
n = 92 (2.42%)
Arginine (Arg, R)
n = 62 (1.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
177 167 199 69 75 295 34 101 86 6 30 23 75 16 94 140
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
52 7 16 53 90 101 4 41 64 71 29 45 64 94 7 66
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
105 166 15 38 80 104 9 15 39 75 68 15 18 56 103 32
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
64 81 10 23 43 85 7 8 13 41 0 0 1 6 0 88
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
754 933 1253 859
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
448 1041 745 1565
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
223 1154 1593 829

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.