Viewing data for Boa constrictor


Scientific name Boa constrictor
Common name Common boa constrictor
Maximum lifespan 40.40 years (Boa constrictor@AnAge)

Total mtDNA (size: 18905 bases) GC AT G C A T
Base content (bases) 7276 11629 4908 2368 4620 7009
Base content per 1 kb (bases) 385 615 260 125 244 371
Base content (%) 38.5% 61.5%
Total protein-coding genes (size: 11248 bases) GC AT G C A T
Base content (bases) 4492 6756 3078 1414 2668 4088
Base content per 1 kb (bases) 399 601 274 126 237 363
Base content (%) 39.9% 60.1%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1467 bases) GC AT G C A T
Base content (bases) 605 862 356 249 360 502
Base content per 1 kb (bases) 412 588 243 170 245 342
Base content (%) 41.2% 58.8%
Total rRNA-coding genes (size: 2458 bases) GC AT G C A T
Base content (bases) 990 1468 571 419 467 1001
Base content per 1 kb (bases) 403 597 232 170 190 407
Base content (%) 40.3% 59.7%
12S rRNA gene (size: 926 bases) GC AT G C A T
Base content (bases) 400 526 231 169 156 370
Base content per 1 kb (bases) 432 568 249 183 168 400
Base content (%) 43.2% 56.8%
16S rRNA gene (size: 1532 bases) GC AT G C A T
Base content (bases) 590 942 340 250 311 631
Base content per 1 kb (bases) 385 615 222 163 203 412
Base content (%) 38.5% 61.5%

ATP6 (size: 680 bases) GC AT G C A T
Base content (bases) 265 415 185 80 175 240
Base content per 1 kb (bases) 390 610 272 118 257 353
Base content (%) 39.0% 61.0%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 45 123 29 16 40 83
Base content per 1 kb (bases) 268 732 173 95 238 494
Base content (%) 26.8% 73.2%
COX1 (size: 1546 bases) GC AT G C A T
Base content (bases) 660 886 407 253 411 475
Base content per 1 kb (bases) 427 573 263 164 266 307
Base content (%) 42.7% 57.3%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 302 385 177 125 152 233
Base content per 1 kb (bases) 440 560 258 182 221 339
Base content (%) 44.0% 56.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 364 420 208 156 193 227
Base content per 1 kb (bases) 464 536 265 199 246 290
Base content (%) 46.4% 53.6%
CYTB (size: 1114 bases) GC AT G C A T
Base content (bases) 458 656 323 135 282 374
Base content per 1 kb (bases) 411 589 290 121 253 336
Base content (%) 41.1% 58.9%
ND1 (size: 967 bases) GC AT G C A T
Base content (bases) 390 577 277 113 225 352
Base content per 1 kb (bases) 403 597 286 117 233 364
Base content (%) 40.3% 59.7%
ND2 (size: 1030 bases) GC AT G C A T
Base content (bases) 406 624 300 106 217 407
Base content per 1 kb (bases) 394 606 291 103 211 395
Base content (%) 39.4% 60.6%
ND3 (size: 343 bases) GC AT G C A T
Base content (bases) 142 201 98 44 89 112
Base content per 1 kb (bases) 414 586 286 128 259 327
Base content (%) 41.4% 58.6%
ND4 (size: 1356 bases) GC AT G C A T
Base content (bases) 519 837 381 138 342 495
Base content per 1 kb (bases) 383 617 281 102 252 365
Base content (%) 38.3% 61.7%
ND4L (size: 290 bases) GC AT G C A T
Base content (bases) 103 187 78 25 73 114
Base content per 1 kb (bases) 355 645 269 86 252 393
Base content (%) 35.5% 64.5%
ND5 (size: 1791 bases) GC AT G C A T
Base content (bases) 669 1122 484 185 397 725
Base content per 1 kb (bases) 374 626 270 103 222 405
Base content (%) 37.4% 62.6%
ND6 (size: 507 bases) GC AT G C A T
Base content (bases) 173 334 134 39 75 259
Base content per 1 kb (bases) 341 659 264 77 148 511
Base content (%) 34.1% 65.9%

ATP6 (size: 680 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (4.0%)
Alanine (Ala, A)
n = 16 (7.11%)
Serine (Ser, S)
n = 17 (7.56%)
Threonine (Thr, T)
n = 22 (9.78%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 10 (4.44%)
Leucine (Leu, L)
n = 38 (16.89%)
Isoleucine (Ile, I)
n = 21 (9.33%)
Methionine (Met, M)
n = 26 (11.56%)
Proline (Pro, P)
n = 12 (5.33%)
Phenylalanine (Phe, F)
n = 10 (4.44%)
Tyrosine (Tyr, Y)
n = 4 (1.78%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 6 (2.67%)
Asparagine (Asn, N)
n = 11 (4.89%)
Glutamine (Gln, Q)
n = 6 (2.67%)
Histidine (His, H)
n = 5 (2.22%)
Lysine (Lys, K)
n = 5 (2.22%)
Arginine (Arg, R)
n = 4 (1.78%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 12 24 5 3 22 1 6 5 1 1 3 4 2 5 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 2 7 6 1 1 1 5 2 0 3 9 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 1 1 1 10 1 0 4 1 3 2 1 2 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 6 0 0 0 2 3 0 0 3 1 0 0 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
41 58 89 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 63 37 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 64 113 31
ATP8 (size: 168 bases)
Amino acid sequence: MPQLDIVFIMMVYTWTWMSLMIMTWKIQKMTMNNVPEKNNMLMNNTEHMPTLPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 1 (1.82%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 11 (20.0%)
Proline (Pro, P)
n = 4 (7.27%)
Phenylalanine (Phe, F)
n = 1 (1.82%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 4 (7.27%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 6 (10.91%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 9 0 0 3 0 1 2 0 0 0 1 2 1 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 0 0 0 0 0 0 0 0 3 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 6 0 0 0 1 0 0 0 0 1 1 0 1 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 1 0 3 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 10 31 9
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 12 17 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 7 35 8
COX1 (size: 1546 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 44 (8.56%)
Alanine (Ala, A)
n = 36 (7.0%)
Serine (Ser, S)
n = 35 (6.81%)
Threonine (Thr, T)
n = 42 (8.17%)
Cysteine (Cys, C)
n = 3 (0.58%)
Valine (Val, V)
n = 31 (6.03%)
Leucine (Leu, L)
n = 57 (11.09%)
Isoleucine (Ile, I)
n = 46 (8.95%)
Methionine (Met, M)
n = 31 (6.03%)
Proline (Pro, P)
n = 29 (5.64%)
Phenylalanine (Phe, F)
n = 45 (8.75%)
Tyrosine (Tyr, Y)
n = 16 (3.11%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 13 (2.53%)
Glutamic acid (Glu, E)
n = 6 (1.17%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 9 (1.75%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 10 (1.95%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 34 24 6 3 27 9 9 7 2 4 7 14 6 14 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 1 2 15 18 1 6 4 28 6 1 5 21 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 25 3 2 2 23 1 2 5 7 9 0 3 7 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 4 2 5 8 8 2 4 0 4 0 0 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
130 109 155 121
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
79 135 91 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 163 229 79
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.95%)
Alanine (Ala, A)
n = 17 (7.46%)
Serine (Ser, S)
n = 12 (5.26%)
Threonine (Thr, T)
n = 21 (9.21%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 22 (9.65%)
Leucine (Leu, L)
n = 25 (10.96%)
Isoleucine (Ile, I)
n = 12 (5.26%)
Methionine (Met, M)
n = 11 (4.82%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 9 (3.95%)
Tyrosine (Tyr, Y)
n = 7 (3.07%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 9 (3.95%)
Glutamic acid (Glu, E)
n = 16 (7.02%)
Asparagine (Asn, N)
n = 8 (3.51%)
Glutamine (Gln, Q)
n = 9 (3.95%)
Histidine (His, H)
n = 8 (3.51%)
Lysine (Lys, K)
n = 5 (2.19%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 9 7 4 1 9 5 5 5 4 3 0 15 4 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 3 8 6 0 1 1 4 3 2 0 10 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 12 1 0 1 9 1 0 1 2 5 0 1 3 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 15 1 1 8 4 1 0 0 5 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 56 58 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 63 63 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 58 112 31
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 18 (6.92%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 23 (8.85%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 12 (4.62%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 21 (8.08%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 6 (2.31%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 6 4 3 2 13 8 8 4 2 1 3 14 5 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 0 10 8 0 3 2 9 7 1 2 7 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 16 2 1 2 8 1 0 3 3 8 4 1 0 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 6 3 1 3 5 1 0 0 3 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 63 57 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 64 57 99
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
40 81 113 27
CYTB (size: 1114 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (5.41%)
Alanine (Ala, A)
n = 26 (7.03%)
Serine (Ser, S)
n = 25 (6.76%)
Threonine (Thr, T)
n = 33 (8.92%)
Cysteine (Cys, C)
n = 2 (0.54%)
Valine (Val, V)
n = 14 (3.78%)
Leucine (Leu, L)
n = 48 (12.97%)
Isoleucine (Ile, I)
n = 35 (9.46%)
Methionine (Met, M)
n = 21 (5.68%)
Proline (Pro, P)
n = 22 (5.95%)
Phenylalanine (Phe, F)
n = 33 (8.92%)
Tyrosine (Tyr, Y)
n = 12 (3.24%)
Tryptophan (Trp, W)
n = 12 (3.24%)
Aspartic acid (Asp, D)
n = 7 (1.89%)
Glutamic acid (Glu, E)
n = 7 (1.89%)
Asparagine (Asn, N)
n = 18 (4.86%)
Glutamine (Gln, Q)
n = 7 (1.89%)
Histidine (His, H)
n = 12 (3.24%)
Lysine (Lys, K)
n = 11 (2.97%)
Arginine (Arg, R)
n = 6 (1.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 28 20 4 4 28 0 10 6 1 2 1 11 0 6 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 1 6 19 0 1 3 9 7 0 6 16 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 20 0 2 7 14 0 0 2 3 9 5 2 2 16 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 2 2 5 11 0 1 0 4 1 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 83 120 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 104 74 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 136 180 36
ND1 (size: 967 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.98%)
Alanine (Ala, A)
n = 21 (6.54%)
Serine (Ser, S)
n = 25 (7.79%)
Threonine (Thr, T)
n = 33 (10.28%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 11 (3.43%)
Leucine (Leu, L)
n = 50 (15.58%)
Isoleucine (Ile, I)
n = 21 (6.54%)
Methionine (Met, M)
n = 32 (9.97%)
Proline (Pro, P)
n = 26 (8.1%)
Phenylalanine (Phe, F)
n = 16 (4.98%)
Tyrosine (Tyr, Y)
n = 10 (3.12%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 10 (3.12%)
Asparagine (Asn, N)
n = 13 (4.05%)
Glutamine (Gln, Q)
n = 8 (2.49%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 9 (2.8%)
Arginine (Arg, R)
n = 7 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 16 28 7 2 30 2 8 8 0 2 4 4 1 1 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 1 5 15 0 1 2 11 2 3 1 21 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 16 2 2 2 19 0 0 2 0 10 1 1 1 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 3 0 3 9 0 0 2 4 1 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 84 110 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 103 55 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 90 187 27
ND2 (size: 1030 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (2.92%)
Alanine (Ala, A)
n = 27 (7.89%)
Serine (Ser, S)
n = 31 (9.06%)
Threonine (Thr, T)
n = 60 (17.54%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.05%)
Leucine (Leu, L)
n = 45 (13.16%)
Isoleucine (Ile, I)
n = 27 (7.89%)
Methionine (Met, M)
n = 43 (12.57%)
Proline (Pro, P)
n = 19 (5.56%)
Phenylalanine (Phe, F)
n = 8 (2.34%)
Tyrosine (Tyr, Y)
n = 5 (1.46%)
Tryptophan (Trp, W)
n = 10 (2.92%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.75%)
Asparagine (Asn, N)
n = 10 (2.92%)
Glutamine (Gln, Q)
n = 8 (2.34%)
Histidine (His, H)
n = 7 (2.05%)
Lysine (Lys, K)
n = 13 (3.8%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 22 39 5 6 27 3 4 7 1 2 1 4 0 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 2 6 17 2 0 1 5 4 3 1 13 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 35 3 2 4 20 1 0 4 1 4 1 0 1 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 2 1 1 11 2 0 0 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 79 157 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 133 51 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 88 199 31
ND3 (size: 1030 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (2.92%)
Alanine (Ala, A)
n = 27 (7.89%)
Serine (Ser, S)
n = 31 (9.06%)
Threonine (Thr, T)
n = 60 (17.54%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.05%)
Leucine (Leu, L)
n = 45 (13.16%)
Isoleucine (Ile, I)
n = 27 (7.89%)
Methionine (Met, M)
n = 43 (12.57%)
Proline (Pro, P)
n = 19 (5.56%)
Phenylalanine (Phe, F)
n = 8 (2.34%)
Tyrosine (Tyr, Y)
n = 5 (1.46%)
Tryptophan (Trp, W)
n = 10 (2.92%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 6 (1.75%)
Asparagine (Asn, N)
n = 10 (2.92%)
Glutamine (Gln, Q)
n = 8 (2.34%)
Histidine (His, H)
n = 7 (2.05%)
Lysine (Lys, K)
n = 13 (3.8%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 22 39 5 6 27 3 4 7 1 2 1 4 0 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 2 6 17 2 0 1 5 4 3 1 13 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 35 3 2 4 20 1 0 4 1 4 1 0 1 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 2 1 1 11 2 0 0 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 79 157 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 133 51 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 88 199 31
ND4 (size: 1356 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (3.33%)
Alanine (Ala, A)
n = 33 (7.32%)
Serine (Ser, S)
n = 31 (6.87%)
Threonine (Thr, T)
n = 56 (12.42%)
Cysteine (Cys, C)
n = 4 (0.89%)
Valine (Val, V)
n = 9 (2.0%)
Leucine (Leu, L)
n = 83 (18.4%)
Isoleucine (Ile, I)
n = 38 (8.43%)
Methionine (Met, M)
n = 42 (9.31%)
Proline (Pro, P)
n = 22 (4.88%)
Phenylalanine (Phe, F)
n = 19 (4.21%)
Tyrosine (Tyr, Y)
n = 12 (2.66%)
Tryptophan (Trp, W)
n = 10 (2.22%)
Aspartic acid (Asp, D)
n = 4 (0.89%)
Glutamic acid (Glu, E)
n = 8 (1.77%)
Asparagine (Asn, N)
n = 17 (3.77%)
Glutamine (Gln, Q)
n = 15 (3.33%)
Histidine (His, H)
n = 12 (2.66%)
Lysine (Lys, K)
n = 12 (2.66%)
Arginine (Arg, R)
n = 9 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 21 36 7 8 44 3 20 13 2 1 0 8 0 4 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 3 3 13 15 2 6 2 6 1 3 5 13 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 36 3 4 3 18 0 3 3 4 8 0 1 1 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 2 0 4 10 2 0 1 8 0 0 1 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 120 172 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 136 80 191
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 125 243 60
ND4L (size: 290 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.21%)
Alanine (Ala, A)
n = 3 (3.16%)
Serine (Ser, S)
n = 4 (4.21%)
Threonine (Thr, T)
n = 19 (20.0%)
Cysteine (Cys, C)
n = 2 (2.11%)
Valine (Val, V)
n = 3 (3.16%)
Leucine (Leu, L)
n = 21 (22.11%)
Isoleucine (Ile, I)
n = 6 (6.32%)
Methionine (Met, M)
n = 13 (13.68%)
Proline (Pro, P)
n = 2 (2.11%)
Phenylalanine (Phe, F)
n = 4 (4.21%)
Tyrosine (Tyr, Y)
n = 1 (1.05%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.05%)
Glutamic acid (Glu, E)
n = 2 (2.11%)
Asparagine (Asn, N)
n = 3 (3.16%)
Glutamine (Gln, Q)
n = 2 (2.11%)
Histidine (His, H)
n = 2 (2.11%)
Lysine (Lys, K)
n = 3 (3.16%)
Arginine (Arg, R)
n = 1 (1.05%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 5 12 4 2 11 1 3 2 0 0 2 1 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 0 0 3 0 0 0 4 0 0 1 0 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 10 0 0 0 2 1 0 1 0 1 0 0 1 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 3 0 0 0 1 0 0 0 0 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
13 25 45 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 27 14 47
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 26 54 12
ND5 (size: 1791 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.53%)
Alanine (Ala, A)
n = 37 (6.21%)
Serine (Ser, S)
n = 41 (6.88%)
Threonine (Thr, T)
n = 76 (12.75%)
Cysteine (Cys, C)
n = 2 (0.34%)
Valine (Val, V)
n = 13 (2.18%)
Leucine (Leu, L)
n = 70 (11.74%)
Isoleucine (Ile, I)
n = 65 (10.91%)
Methionine (Met, M)
n = 60 (10.07%)
Proline (Pro, P)
n = 26 (4.36%)
Phenylalanine (Phe, F)
n = 28 (4.7%)
Tyrosine (Tyr, Y)
n = 9 (1.51%)
Tryptophan (Trp, W)
n = 11 (1.85%)
Aspartic acid (Asp, D)
n = 12 (2.01%)
Glutamic acid (Glu, E)
n = 12 (2.01%)
Asparagine (Asn, N)
n = 33 (5.54%)
Glutamine (Gln, Q)
n = 21 (3.52%)
Histidine (His, H)
n = 17 (2.85%)
Lysine (Lys, K)
n = 28 (4.7%)
Arginine (Arg, R)
n = 8 (1.34%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 48 52 4 10 41 4 11 18 3 1 0 11 1 7 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 2 3 11 23 0 5 4 14 4 3 2 20 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 54 2 6 1 26 2 0 6 2 7 4 0 4 29 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 12 0 3 9 27 1 0 1 7 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
101 131 268 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 174 133 236
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 179 324 64
ND6 (size: 507 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (11.31%)
Alanine (Ala, A)
n = 3 (1.79%)
Serine (Ser, S)
n = 15 (8.93%)
Threonine (Thr, T)
n = 3 (1.79%)
Cysteine (Cys, C)
n = 8 (4.76%)
Valine (Val, V)
n = 27 (16.07%)
Leucine (Leu, L)
n = 19 (11.31%)
Isoleucine (Ile, I)
n = 14 (8.33%)
Methionine (Met, M)
n = 10 (5.95%)
Proline (Pro, P)
n = 1 (0.6%)
Phenylalanine (Phe, F)
n = 19 (11.31%)
Tyrosine (Tyr, Y)
n = 9 (5.36%)
Tryptophan (Trp, W)
n = 4 (2.38%)
Aspartic acid (Asp, D)
n = 3 (1.79%)
Glutamic acid (Glu, E)
n = 2 (1.19%)
Asparagine (Asn, N)
n = 3 (1.79%)
Glutamine (Gln, Q)
n = 2 (1.19%)
Histidine (His, H)
n = 1 (0.6%)
Lysine (Lys, K)
n = 1 (0.6%)
Arginine (Arg, R)
n = 5 (2.98%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 1 5 3 0 0 2 2 1 1 21 2 1 3 19 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 8 0 2 1 0 0 10 1 2 6 0 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 6 0 3 1 5 0 9 0 2 12 3 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 2 2 1 0 1 2 0 1 2 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 14 37 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 17 21 89
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 8 17 106
Total protein-coding genes (size: 11263 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 199 (5.31%)
Alanine (Ala, A)
n = 241 (6.43%)
Serine (Ser, S)
n = 260 (6.93%)
Threonine (Thr, T)
n = 407 (10.85%)
Cysteine (Cys, C)
n = 29 (0.77%)
Valine (Val, V)
n = 177 (4.72%)
Leucine (Leu, L)
n = 519 (13.84%)
Isoleucine (Ile, I)
n = 313 (8.35%)
Methionine (Met, M)
n = 314 (8.37%)
Proline (Pro, P)
n = 195 (5.2%)
Phenylalanine (Phe, F)
n = 218 (5.81%)
Tyrosine (Tyr, Y)
n = 101 (2.69%)
Tryptophan (Trp, W)
n = 99 (2.64%)
Aspartic acid (Asp, D)
n = 63 (1.68%)
Glutamic acid (Glu, E)
n = 91 (2.43%)
Asparagine (Asn, N)
n = 150 (4.0%)
Glutamine (Gln, Q)
n = 97 (2.59%)
Histidine (His, H)
n = 102 (2.72%)
Lysine (Lys, K)
n = 108 (2.88%)
Arginine (Arg, R)
n = 63 (1.68%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
101 212 264 55 43 267 39 91 79 18 39 24 90 24 70 148
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
50 16 13 19 83 133 6 35 23 99 42 16 27 139 13 32
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
112 246 17 26 24 158 9 10 33 32 69 20 24 26 124 22
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
80 71 20 17 46 95 13 8 4 44 7 0 2 3 0 79
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
771 861 1337 782
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
435 1060 715 1541
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
304 1065 1858 524

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.