Viewing data for Ambystoma tigrinum


Scientific name Ambystoma tigrinum
Common name Tiger salamander
Maximum lifespan 25.00 years (Ambystoma tigrinum@AnAge)

Total mtDNA (size: 16375 bases) GC AT G C A T
Base content (bases) 5414 10961 3230 2184 5276 5685
Base content per 1 kb (bases) 331 669 197 133 322 347
Base content (%) 33.1% 66.9%
Total protein-coding genes (size: 11325 bases) GC AT G C A T
Base content (bases) 3663 7662 2271 1392 3840 3822
Base content per 1 kb (bases) 323 677 201 123 339 337
Base content (%) 32.3% 67.7%
D-loop (size: 737 bases) GC AT G C A T
Base content (bases) 277 460 157 120 235 225
Base content per 1 kb (bases) 376 624 213 163 319 305
Base content (%) 37.6% 62.4%
Total tRNA-coding genes (size: 1569 bases) GC AT G C A T
Base content (bases) 504 1065 286 218 486 579
Base content per 1 kb (bases) 321 679 182 139 310 369
Base content (%) 32.1% 67.9%
Total rRNA-coding genes (size: 2483 bases) GC AT G C A T
Base content (bases) 867 1616 449 418 637 979
Base content per 1 kb (bases) 349 651 181 168 257 394
Base content (%) 34.9% 65.1%
12S rRNA gene (size: 928 bases) GC AT G C A T
Base content (bases) 355 573 190 165 220 353
Base content per 1 kb (bases) 383 617 205 178 237 380
Base content (%) 38.3% 61.7%
16S rRNA gene (size: 1555 bases) GC AT G C A T
Base content (bases) 512 1043 259 253 417 626
Base content per 1 kb (bases) 329 671 167 163 268 403
Base content (%) 32.9% 67.1%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 227 457 153 74 239 218
Base content per 1 kb (bases) 332 668 224 108 349 319
Base content (%) 33.2% 66.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 41 127 30 11 57 70
Base content per 1 kb (bases) 244 756 179 65 339 417
Base content (%) 24.4% 75.6%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 556 992 298 258 539 453
Base content per 1 kb (bases) 359 641 193 167 348 293
Base content (%) 35.9% 64.1%
COX2 (size: 686 bases) GC AT G C A T
Base content (bases) 247 439 145 102 203 236
Base content per 1 kb (bases) 360 640 211 149 296 344
Base content (%) 36.0% 64.0%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 282 503 159 123 264 239
Base content per 1 kb (bases) 359 641 203 157 336 304
Base content (%) 35.9% 64.1%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 368 773 230 138 404 369
Base content per 1 kb (bases) 323 677 202 121 354 323
Base content (%) 32.3% 67.7%
ND1 (size: 972 bases) GC AT G C A T
Base content (bases) 299 673 193 106 349 324
Base content per 1 kb (bases) 308 692 199 109 359 333
Base content (%) 30.8% 69.2%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 297 747 197 100 343 404
Base content per 1 kb (bases) 284 716 189 96 329 387
Base content (%) 28.4% 71.6%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 115 233 71 44 126 107
Base content per 1 kb (bases) 330 670 204 126 362 307
Base content (%) 33.0% 67.0%
ND4 (size: 1375 bases) GC AT G C A T
Base content (bases) 439 936 285 154 470 466
Base content per 1 kb (bases) 319 681 207 112 342 339
Base content (%) 31.9% 68.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 95 202 63 32 108 94
Base content per 1 kb (bases) 320 680 212 108 364 316
Base content (%) 32.0% 68.0%
ND5 (size: 1800 bases) GC AT G C A T
Base content (bases) 540 1260 343 197 644 616
Base content per 1 kb (bases) 300 700 191 109 358 342
Base content (%) 30.0% 70.0%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 172 347 113 59 104 243
Base content per 1 kb (bases) 331 669 218 114 200 468
Base content (%) 33.1% 66.9%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 9 (3.96%)
Threonine (Thr, T)
n = 24 (10.57%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 54 (23.79%)
Isoleucine (Ile, I)
n = 22 (9.69%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 12 (5.29%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 3 9 10 2 14 1 25 8 0 3 2 4 0 10 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 9 3 6 0 2 1 4 2 3 0 12 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 12 0 1 1 3 0 0 4 4 0 0 2 3 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 1 1 1 3 0 1 2 2 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 59 73 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 63 34 108
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 31 111 77
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPGPWFAILIMSWFIYLFILMSKTNNFKYNNDPNMQNVKKIKPQSWNWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 2 (3.64%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 4 (7.27%)
Proline (Pro, P)
n = 6 (10.91%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 2 (3.64%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 8 (14.55%)
Glutamine (Gln, Q)
n = 3 (5.45%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 3 0 0 1 0 3 3 0 0 0 1 0 4 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 1 0 0 2 1 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 3 0 0 0 0 0 2 0 0 0 6 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 1 5 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 10 24 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 12 20 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 8 26 21
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.74%)
Alanine (Ala, A)
n = 43 (8.35%)
Serine (Ser, S)
n = 37 (7.18%)
Threonine (Thr, T)
n = 35 (6.8%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 41 (7.96%)
Leucine (Leu, L)
n = 61 (11.84%)
Isoleucine (Ile, I)
n = 38 (7.38%)
Methionine (Met, M)
n = 29 (5.63%)
Proline (Pro, P)
n = 26 (5.05%)
Phenylalanine (Phe, F)
n = 40 (7.77%)
Tyrosine (Tyr, Y)
n = 18 (3.5%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 16 (3.11%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 19 (3.69%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 7 26 13 2 14 4 28 5 2 15 2 21 3 32 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 11 8 24 0 12 6 19 8 9 4 13 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 18 4 10 2 20 1 0 4 17 1 1 0 9 7 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 1 12 3 8 0 1 0 7 1 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
154 94 130 138
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 137 94 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 67 229 192
COX2 (size: 686 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 23 (10.13%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 11 (4.85%)
Glutamic acid (Glu, E)
n = 13 (5.73%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 2 14 6 0 7 0 10 9 0 4 2 5 3 7 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 3 6 6 0 2 0 4 3 1 0 11 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 7 0 3 2 8 0 1 2 5 3 0 0 5 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 10 3 8 3 3 0 0 0 5 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 51 68 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 57 63 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 37 104 72
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 19 (7.31%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 35 (13.46%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 6 (2.31%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 14 (5.38%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 4 9 4 0 10 0 21 8 0 10 3 4 0 17 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 7 3 10 1 3 3 9 5 1 0 11 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 13 0 5 0 7 0 0 3 8 3 0 0 3 2 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 9 0 3 3 2 0 1 0 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 53 54 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 64 55 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 42 129 82
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 21 (5.54%)
Serine (Ser, S)
n = 28 (7.39%)
Threonine (Thr, T)
n = 22 (5.8%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 14 (3.69%)
Leucine (Leu, L)
n = 49 (12.93%)
Isoleucine (Ile, I)
n = 43 (11.35%)
Methionine (Met, M)
n = 21 (5.54%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 34 (8.97%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 9 19 12 0 19 0 18 8 1 6 0 7 1 22 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 7 5 9 0 2 5 17 2 3 0 17 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 0 7 3 15 1 1 1 11 2 0 0 12 6 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 7 0 7 1 8 2 1 1 6 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 82 116 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 91 77 161
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 57 176 136
ND1 (size: 969 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.97%)
Alanine (Ala, A)
n = 22 (6.83%)
Serine (Ser, S)
n = 24 (7.45%)
Threonine (Thr, T)
n = 25 (7.76%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 12 (3.73%)
Leucine (Leu, L)
n = 60 (18.63%)
Isoleucine (Ile, I)
n = 27 (8.39%)
Methionine (Met, M)
n = 20 (6.21%)
Proline (Pro, P)
n = 21 (6.52%)
Phenylalanine (Phe, F)
n = 23 (7.14%)
Tyrosine (Tyr, Y)
n = 11 (3.42%)
Tryptophan (Trp, W)
n = 7 (2.17%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 11 (3.42%)
Asparagine (Asn, N)
n = 15 (4.66%)
Glutamine (Gln, Q)
n = 8 (2.48%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 6 (1.86%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 7 19 10 0 17 0 32 8 0 3 1 8 0 20 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 5 5 11 1 5 3 7 1 5 2 13 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 12 0 6 0 15 1 0 2 9 2 0 1 9 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 10 1 2 1 6 0 2 1 5 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
64 66 95 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 90 57 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 37 171 108
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 23 (6.63%)
Serine (Ser, S)
n = 30 (8.65%)
Threonine (Thr, T)
n = 38 (10.95%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 54 (15.56%)
Isoleucine (Ile, I)
n = 36 (10.37%)
Methionine (Met, M)
n = 39 (11.24%)
Proline (Pro, P)
n = 16 (4.61%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 21 (6.05%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 5 36 7 2 10 2 32 9 2 1 2 4 0 11 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 8 0 15 0 1 1 10 2 2 1 10 3 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 19 0 4 1 20 1 1 3 5 1 0 1 14 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 1 1 0 10 0 0 0 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 58 148 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 103 61 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 36 195 102
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.03%)
Alanine (Ala, A)
n = 23 (6.63%)
Serine (Ser, S)
n = 30 (8.65%)
Threonine (Thr, T)
n = 38 (10.95%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 54 (15.56%)
Isoleucine (Ile, I)
n = 36 (10.37%)
Methionine (Met, M)
n = 39 (11.24%)
Proline (Pro, P)
n = 16 (4.61%)
Phenylalanine (Phe, F)
n = 13 (3.75%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 21 (6.05%)
Glutamine (Gln, Q)
n = 11 (3.17%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 5 36 7 2 10 2 32 9 2 1 2 4 0 11 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 8 0 15 0 1 1 10 2 2 1 10 3 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 19 0 4 1 20 1 1 3 5 1 0 1 14 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 1 1 0 10 0 0 0 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 58 148 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 103 61 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 36 195 102
ND4 (size: 1375 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.6%)
Alanine (Ala, A)
n = 26 (5.69%)
Serine (Ser, S)
n = 34 (7.44%)
Threonine (Thr, T)
n = 35 (7.66%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 87 (19.04%)
Isoleucine (Ile, I)
n = 43 (9.41%)
Methionine (Met, M)
n = 36 (7.88%)
Proline (Pro, P)
n = 23 (5.03%)
Phenylalanine (Phe, F)
n = 20 (4.38%)
Tyrosine (Tyr, Y)
n = 17 (3.72%)
Tryptophan (Trp, W)
n = 14 (3.06%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 12 (2.63%)
Asparagine (Asn, N)
n = 19 (4.16%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 10 (2.19%)
Lysine (Lys, K)
n = 15 (3.28%)
Arginine (Arg, R)
n = 11 (2.41%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
35 8 29 27 3 23 2 32 14 0 4 4 5 0 17 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 3 3 4 9 12 1 4 2 9 6 6 3 14 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 20 1 5 3 19 0 2 5 15 2 2 0 13 6 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 2 1 1 15 0 2 1 8 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 113 155 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
59 111 89 199
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 61 222 154
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 9 (9.18%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 2 7 8 0 0 1 9 2 0 0 0 1 0 5 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 3 0 5 0 0 1 3 0 0 0 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 7 0 5 0 4 0 1 1 0 0 0 0 2 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 1 1 0 1 1 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
16 20 33 30
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
12 29 14 44
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 14 47 34
ND5 (size: 1800 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.67%)
Alanine (Ala, A)
n = 38 (6.34%)
Serine (Ser, S)
n = 55 (9.18%)
Threonine (Thr, T)
n = 44 (7.35%)
Cysteine (Cys, C)
n = 6 (1.0%)
Valine (Val, V)
n = 19 (3.17%)
Leucine (Leu, L)
n = 88 (14.69%)
Isoleucine (Ile, I)
n = 63 (10.52%)
Methionine (Met, M)
n = 37 (6.18%)
Proline (Pro, P)
n = 25 (4.17%)
Phenylalanine (Phe, F)
n = 42 (7.01%)
Tyrosine (Tyr, Y)
n = 16 (2.67%)
Tryptophan (Trp, W)
n = 13 (2.17%)
Aspartic acid (Asp, D)
n = 13 (2.17%)
Glutamic acid (Glu, E)
n = 13 (2.17%)
Asparagine (Asn, N)
n = 34 (5.68%)
Glutamine (Gln, Q)
n = 22 (3.67%)
Histidine (His, H)
n = 10 (1.67%)
Lysine (Lys, K)
n = 24 (4.01%)
Arginine (Arg, R)
n = 9 (1.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
50 13 31 18 3 22 1 44 21 1 5 1 12 1 31 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 4 2 15 8 15 0 8 4 13 3 10 1 12 2 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 27 2 18 6 21 1 5 4 13 3 1 0 23 11 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 13 0 10 3 22 2 3 0 6 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
111 110 212 167
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
66 153 132 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 80 272 228
ND6 (size: 513 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (11.76%)
Alanine (Ala, A)
n = 13 (7.65%)
Serine (Ser, S)
n = 16 (9.41%)
Threonine (Thr, T)
n = 3 (1.76%)
Cysteine (Cys, C)
n = 4 (2.35%)
Valine (Val, V)
n = 19 (11.18%)
Leucine (Leu, L)
n = 27 (15.88%)
Isoleucine (Ile, I)
n = 9 (5.29%)
Methionine (Met, M)
n = 9 (5.29%)
Proline (Pro, P)
n = 4 (2.35%)
Phenylalanine (Phe, F)
n = 18 (10.59%)
Tyrosine (Tyr, Y)
n = 11 (6.47%)
Tryptophan (Trp, W)
n = 3 (1.76%)
Aspartic acid (Asp, D)
n = 4 (2.35%)
Glutamic acid (Glu, E)
n = 4 (2.35%)
Asparagine (Asn, N)
n = 2 (1.18%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.59%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.76%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 1 6 3 0 1 0 21 0 0 11 1 7 0 13 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 1 4 1 6 2 10 2 4 4 1 1 0 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 9 1 2 1 3 0 11 0 0 2 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 4 0 0 0 2 0 1 0 1 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 12 27 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 33 22 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 13 53 87
Total protein-coding genes (size: 11358 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 219 (5.79%)
Alanine (Ala, A)
n = 256 (6.77%)
Serine (Ser, S)
n = 285 (7.53%)
Threonine (Thr, T)
n = 278 (7.35%)
Cysteine (Cys, C)
n = 31 (0.82%)
Valine (Val, V)
n = 169 (4.47%)
Leucine (Leu, L)
n = 586 (15.49%)
Isoleucine (Ile, I)
n = 339 (8.96%)
Methionine (Met, M)
n = 250 (6.61%)
Proline (Pro, P)
n = 196 (5.18%)
Phenylalanine (Phe, F)
n = 254 (6.71%)
Tyrosine (Tyr, Y)
n = 119 (3.15%)
Tryptophan (Trp, W)
n = 110 (2.91%)
Aspartic acid (Asp, D)
n = 72 (1.9%)
Glutamic acid (Glu, E)
n = 95 (2.51%)
Asparagine (Asn, N)
n = 163 (4.31%)
Glutamine (Gln, Q)
n = 103 (2.72%)
Histidine (His, H)
n = 90 (2.38%)
Lysine (Lys, K)
n = 88 (2.33%)
Arginine (Arg, R)
n = 72 (1.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
275 64 214 121 14 145 12 288 97 6 62 18 81 8 198 56
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
36 17 14 78 51 122 5 50 30 103 36 43 13 126 14 76
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
41 154 7 80 20 136 6 14 29 100 19 5 6 103 60 46
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
44 81 14 51 21 84 4 13 6 51 2 2 0 6 1 105
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
811 753 1163 1057
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
477 972 737 1598
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
162 500 1795 1327

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.