Viewing data for Vulpes lagopus


Scientific name Vulpes lagopus
Common name Arctic fox
Maximum lifespan 16.30 years (Vulpes lagopus@AnAge)

Total mtDNA (size: 16656 bases) GC AT G C A T
Base content (bases) 6820 9836 4359 2461 4622 5214
Base content per 1 kb (bases) 409 591 262 148 277 313
Base content (%) 40.9% 59.1%
Total protein-coding genes (size: 11339 bases) GC AT G C A T
Base content (bases) 4721 6618 3147 1574 3235 3383
Base content per 1 kb (bases) 416 584 278 139 285 298
Base content (%) 41.6% 58.4%
D-loop (size: 1196 bases) GC AT G C A T
Base content (bases) 529 667 350 179 312 355
Base content per 1 kb (bases) 442 558 293 150 261 297
Base content (%) 44.2% 55.8%
Total tRNA-coding genes (size: 1510 bases) GC AT G C A T
Base content (bases) 550 960 311 239 437 523
Base content per 1 kb (bases) 364 636 206 158 289 346
Base content (%) 36.4% 63.6%
Total rRNA-coding genes (size: 2536 bases) GC AT G C A T
Base content (bases) 986 1550 533 453 623 927
Base content per 1 kb (bases) 389 611 210 179 246 366
Base content (%) 38.9% 61.1%
12S rRNA gene (size: 957 bases) GC AT G C A T
Base content (bases) 388 569 211 177 223 346
Base content per 1 kb (bases) 405 595 220 185 233 362
Base content (%) 40.5% 59.5%
16S rRNA gene (size: 1579 bases) GC AT G C A T
Base content (bases) 598 981 322 276 400 581
Base content per 1 kb (bases) 379 621 204 175 253 368
Base content (%) 37.9% 62.1%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 282 399 197 85 196 203
Base content per 1 kb (bases) 414 586 289 125 288 298
Base content (%) 41.4% 58.6%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 79 125 58 21 53 72
Base content per 1 kb (bases) 387 613 284 103 260 353
Base content (%) 38.7% 61.3%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 665 880 383 282 467 413
Base content per 1 kb (bases) 430 570 248 183 302 267
Base content (%) 43.0% 57.0%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 269 415 172 97 189 226
Base content per 1 kb (bases) 393 607 251 142 276 330
Base content (%) 39.3% 60.7%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 346 438 223 123 232 206
Base content per 1 kb (bases) 441 559 284 157 296 263
Base content (%) 44.1% 55.9%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 500 640 337 163 316 324
Base content per 1 kb (bases) 439 561 296 143 277 284
Base content (%) 43.9% 56.1%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 412 544 279 133 285 259
Base content per 1 kb (bases) 431 569 292 139 298 271
Base content (%) 43.1% 56.9%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 396 646 291 105 288 358
Base content per 1 kb (bases) 380 620 279 101 276 344
Base content (%) 38.0% 62.0%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 158 189 101 57 94 95
Base content per 1 kb (bases) 455 545 291 164 271 274
Base content (%) 45.5% 54.5%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 579 799 398 181 392 407
Base content per 1 kb (bases) 420 580 289 131 284 295
Base content (%) 42.0% 58.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 118 179 71 47 94 85
Base content per 1 kb (bases) 397 603 239 158 316 286
Base content (%) 39.7% 60.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 742 1079 508 234 530 549
Base content per 1 kb (bases) 407 593 279 129 291 301
Base content (%) 40.7% 59.3%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 200 328 147 53 118 210
Base content per 1 kb (bases) 379 621 278 100 223 398
Base content (%) 37.9% 62.1%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 23 (10.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 42 (18.58%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 13 8 5 4 19 3 10 6 3 1 3 5 0 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 7 8 4 0 0 3 3 5 3 7 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 10 1 6 0 3 1 2 1 1 1 1 1 7 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 0 0 1 4 0 0 1 4 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 65 80 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 65 38 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 67 85 55
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFTMILSMTLTLFILFQLKVSKHYYPENPGPKSVKSTSKHIPWEDKWTKIYSPLSLPPQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.49%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 8 (11.94%)
Threonine (Thr, T)
n = 7 (10.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (2.99%)
Leucine (Leu, L)
n = 8 (11.94%)
Isoleucine (Ile, I)
n = 4 (5.97%)
Methionine (Met, M)
n = 3 (4.48%)
Proline (Pro, P)
n = 8 (11.94%)
Phenylalanine (Phe, F)
n = 3 (4.48%)
Tyrosine (Tyr, Y)
n = 3 (4.48%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 2 (2.99%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 1 (1.49%)
Glutamine (Gln, Q)
n = 3 (4.48%)
Histidine (His, H)
n = 2 (2.99%)
Lysine (Lys, K)
n = 7 (10.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 2 1 1 4 1 1 2 1 1 0 1 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 1 0 3 1 3 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 1 1 2 1 2 2 0 1 1 2 0 0 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 1 1 6 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
7 20 23 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 22 21 20
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 16 28 15
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 41 (7.98%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 36 (7.0%)
Leucine (Leu, L)
n = 58 (11.28%)
Isoleucine (Ile, I)
n = 39 (7.59%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 16 26 10 3 17 7 16 6 1 7 6 19 4 18 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 12 13 13 3 6 13 17 11 12 7 8 1 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 13 5 8 7 8 4 0 3 5 14 2 5 5 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 4 6 7 8 9 0 1 1 5 1 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 98 140 128
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 96 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
57 150 177 131
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 7 14 5 3 12 2 12 6 1 6 4 4 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 1 4 2 2 0 3 3 2 2 2 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 6 0 6 2 5 0 1 3 2 9 0 0 2 4 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 4 4 6 3 1 0 0 5 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 55 67 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 61 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 63 98 51
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 22 (8.46%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 10 (3.85%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 7 9 7 4 16 2 2 6 1 6 6 5 0 10 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 2 9 3 0 3 4 10 4 2 3 4 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 0 8 6 4 1 0 3 6 7 2 0 4 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 5 2 1 3 1 1 1 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 68 60 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 57 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 89 89 66
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 55 (14.51%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 23 10 2 17 22 4 7 4 2 3 7 8 0 10 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 3 5 7 12 2 2 5 16 2 7 6 9 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 0 4 7 10 2 1 1 4 10 0 3 5 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 1 3 9 6 3 0 2 5 1 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
87 94 109 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 96 77 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 147 138 71
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 22 (6.94%)
Threonine (Thr, T)
n = 20 (6.31%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 14 (4.42%)
Leucine (Leu, L)
n = 56 (17.67%)
Isoleucine (Ile, I)
n = 31 (9.78%)
Methionine (Met, M)
n = 17 (5.36%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 22 (6.94%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 17 12 8 13 18 6 9 5 1 3 4 6 1 9 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 3 17 8 1 0 3 6 3 7 7 7 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 8 2 4 4 11 1 0 2 5 6 2 2 5 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 6 3 0 6 1 2 1 5 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 85 90 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 91 55 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 103 113 70
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 20 (5.78%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 55 (15.9%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 37 (10.69%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 21 32 6 10 24 4 7 6 3 3 4 2 0 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 4 5 10 1 2 5 8 0 6 6 8 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 20 0 3 14 9 1 0 4 4 5 1 4 5 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 1 0 2 14 1 0 0 2 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 81 145 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 105 58 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 105 155 65
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 20 (5.78%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 55 (15.9%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 37 (10.69%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 21 32 6 10 24 4 7 6 3 3 4 2 0 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 4 5 10 1 2 5 8 0 6 6 8 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 20 0 3 14 9 1 0 4 4 5 1 4 5 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 1 0 2 14 1 0 0 2 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 81 145 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 105 58 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 105 155 65
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 12 (2.62%)
Leucine (Leu, L)
n = 95 (20.74%)
Isoleucine (Ile, I)
n = 44 (9.61%)
Methionine (Met, M)
n = 32 (6.99%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 17 (3.71%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 21 27 13 16 38 14 6 7 4 3 1 7 1 3 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 7 9 12 3 2 7 5 3 4 8 10 2 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 15 2 10 9 7 2 5 5 6 11 3 8 9 14 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 4 1 2 9 4 1 2 5 2 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 136 160 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 121 85 200
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
57 141 162 99
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 9 (9.18%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 7 1 2 10 6 2 2 0 1 1 5 2 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 1 2 3 0 0 2 1 1 0 0 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 1 4 4 0 0 1 3 1 0 1 3 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 0 0 0 0 0 1 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 25 28 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 20 18 52
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 26 39 18
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.79%)
Alanine (Ala, A)
n = 43 (7.1%)
Serine (Ser, S)
n = 52 (8.58%)
Threonine (Thr, T)
n = 50 (8.25%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 21 (3.47%)
Leucine (Leu, L)
n = 89 (14.69%)
Isoleucine (Ile, I)
n = 54 (8.91%)
Methionine (Met, M)
n = 45 (7.43%)
Proline (Pro, P)
n = 23 (3.8%)
Phenylalanine (Phe, F)
n = 42 (6.93%)
Tyrosine (Tyr, Y)
n = 21 (3.47%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 12 (1.98%)
Glutamic acid (Glu, E)
n = 10 (1.65%)
Asparagine (Asn, N)
n = 28 (4.62%)
Glutamine (Gln, Q)
n = 18 (2.97%)
Histidine (His, H)
n = 17 (2.81%)
Lysine (Lys, K)
n = 25 (4.13%)
Arginine (Arg, R)
n = 10 (1.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 30 35 11 26 29 9 11 14 4 5 3 11 2 16 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 1 4 5 19 19 0 7 8 9 5 8 7 7 1 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 11 3 9 14 11 5 8 5 10 11 1 3 15 13 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 3 2 10 22 3 1 4 4 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
115 143 215 134
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 155 132 251
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 210 202 145
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.57%)
Alanine (Ala, A)
n = 11 (6.29%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 12 (6.86%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 21 (12.0%)
Leucine (Leu, L)
n = 21 (12.0%)
Isoleucine (Ile, I)
n = 15 (8.57%)
Methionine (Met, M)
n = 9 (5.14%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 12 (6.86%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 1 3 0 0 1 3 9 1 0 6 0 8 7 10 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 2 6 2 0 3 11 1 5 5 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 1 5 0 1 0 4 1 8 1 4 8 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 6 4 1 1 3 1 0 0 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 9 49 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 32 32 78
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 12 37 81
Total protein-coding genes (size: 11407 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 260 (6.84%)
Serine (Ser, S)
n = 286 (7.53%)
Threonine (Thr, T)
n = 309 (8.13%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 186 (4.9%)
Leucine (Leu, L)
n = 591 (15.56%)
Isoleucine (Ile, I)
n = 333 (8.77%)
Methionine (Met, M)
n = 251 (6.61%)
Proline (Pro, P)
n = 193 (5.08%)
Phenylalanine (Phe, F)
n = 229 (6.03%)
Tyrosine (Tyr, Y)
n = 136 (3.58%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 73 (1.92%)
Glutamic acid (Glu, E)
n = 93 (2.45%)
Asparagine (Asn, N)
n = 150 (3.95%)
Glutamine (Gln, Q)
n = 88 (2.32%)
Histidine (His, H)
n = 102 (2.68%)
Lysine (Lys, K)
n = 103 (2.71%)
Arginine (Arg, R)
n = 66 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
168 165 191 72 106 220 66 92 67 21 47 39 83 17 95 134
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
60 7 17 56 96 90 18 34 55 85 41 58 57 69 9 78
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
101 113 17 66 70 76 21 22 31 56 80 18 35 67 83 30
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
72 59 34 28 45 83 20 7 12 39 8 1 0 7 0 86
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
827 913 1200 860
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
463 995 752 1590
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
385 1163 1361 891

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.