Viewing data for Lampetra aepyptera


Scientific name Lampetra aepyptera
Common name Least brook lamprey
Maximum lifespan 8.00 years (Lampetra aepyptera@AnAge)

Total mtDNA (size: 16236 bases) GC AT G C A T
Base content (bases) 6228 10008 3932 2296 4861 5147
Base content per 1 kb (bases) 384 616 242 141 299 317
Base content (%) 38.4% 61.6%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 4347 7031 2851 1496 3501 3530
Base content per 1 kb (bases) 382 618 251 131 308 310
Base content (%) 38.2% 61.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1530 bases) GC AT G C A T
Base content (bases) 602 928 340 262 426 502
Base content per 1 kb (bases) 393 607 222 171 278 328
Base content (%) 39.3% 60.7%
Total rRNA-coding genes (size: 2518 bases) GC AT G C A T
Base content (bases) 1027 1491 578 449 605 886
Base content per 1 kb (bases) 408 592 230 178 240 352
Base content (%) 40.8% 59.2%
12S rRNA gene (size: 902 bases) GC AT G C A T
Base content (bases) 407 495 239 168 198 297
Base content per 1 kb (bases) 451 549 265 186 220 329
Base content (%) 45.1% 54.9%
16S rRNA gene (size: 1616 bases) GC AT G C A T
Base content (bases) 620 996 339 281 407 589
Base content per 1 kb (bases) 384 616 210 174 252 364
Base content (%) 38.4% 61.6%

ATP6 (size: 679 bases) GC AT G C A T
Base content (bases) 249 430 176 73 219 211
Base content per 1 kb (bases) 367 633 259 108 323 311
Base content (%) 36.7% 63.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 62 106 48 14 48 58
Base content per 1 kb (bases) 369 631 286 83 286 345
Base content (%) 36.9% 63.1%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 612 942 365 247 502 440
Base content per 1 kb (bases) 394 606 235 159 323 283
Base content (%) 39.4% 60.6%
COX2 (size: 690 bases) GC AT G C A T
Base content (bases) 256 434 156 100 216 218
Base content per 1 kb (bases) 371 629 226 145 313 316
Base content (%) 37.1% 62.9%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 334 452 208 126 235 217
Base content per 1 kb (bases) 425 575 265 160 299 276
Base content (%) 42.5% 57.5%
CYTB (size: 1191 bases) GC AT G C A T
Base content (bases) 462 729 281 181 398 331
Base content per 1 kb (bases) 388 612 236 152 334 278
Base content (%) 38.8% 61.2%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 367 599 220 147 325 274
Base content per 1 kb (bases) 380 620 228 152 336 284
Base content (%) 38.0% 62.0%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 391 651 268 123 312 339
Base content per 1 kb (bases) 375 625 257 118 299 325
Base content (%) 37.5% 62.5%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 148 203 100 48 114 89
Base content per 1 kb (bases) 422 578 285 137 325 254
Base content (%) 42.2% 57.8%
ND4 (size: 1377 bases) GC AT G C A T
Base content (bases) 504 873 361 143 440 433
Base content per 1 kb (bases) 366 634 262 104 320 314
Base content (%) 36.6% 63.4%
ND4L (size: 291 bases) GC AT G C A T
Base content (bases) 111 180 78 33 90 90
Base content per 1 kb (bases) 381 619 268 113 309 309
Base content (%) 38.1% 61.9%
ND5 (size: 1797 bases) GC AT G C A T
Base content (bases) 664 1133 457 207 534 599
Base content per 1 kb (bases) 370 630 254 115 297 333
Base content (%) 37.0% 63.0%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 202 317 141 61 76 241
Base content per 1 kb (bases) 389 611 272 118 146 464
Base content (%) 38.9% 61.1%

ATP6 (size: 679 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.56%)
Alanine (Ala, A)
n = 19 (8.44%)
Serine (Ser, S)
n = 9 (4.0%)
Threonine (Thr, T)
n = 25 (11.11%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 9 (4.0%)
Leucine (Leu, L)
n = 51 (22.67%)
Isoleucine (Ile, I)
n = 23 (10.22%)
Methionine (Met, M)
n = 15 (6.67%)
Proline (Pro, P)
n = 15 (6.67%)
Phenylalanine (Phe, F)
n = 9 (4.0%)
Tyrosine (Tyr, Y)
n = 5 (2.22%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 5 (2.22%)
Asparagine (Asn, N)
n = 7 (3.11%)
Glutamine (Gln, Q)
n = 9 (4.0%)
Histidine (His, H)
n = 4 (1.78%)
Lysine (Lys, K)
n = 5 (2.22%)
Arginine (Arg, R)
n = 3 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 11 11 9 6 18 0 16 9 0 2 5 2 0 9 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 8 5 5 1 0 2 3 3 5 1 6 3 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 3 1 3 0 1 1 4 1 0 2 4 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 1 1 0 5 0 0 1 2 0 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 64 77 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 66 36 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 46 98 68
ATP8 (size: 168 bases)
Amino acid sequence: MPQLEPAPWFSMLTVSWLIILLLIMPTIMFYQTQNTISAQQATKPKQPTWTWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 4 (7.27%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.82%)
Asparagine (Asn, N)
n = 1 (1.82%)
Glutamine (Gln, Q)
n = 6 (10.91%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 1 2 2 0 1 0 3 6 0 0 0 1 0 2 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 1 0 0 0 0 0 0 1 3 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 2 0 1 0 0 0 0 1 0 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 1 0 0 2 0 0 0 0 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 17 19 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 20 13 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 11 26 15
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 44 (8.51%)
Alanine (Ala, A)
n = 45 (8.7%)
Serine (Ser, S)
n = 29 (5.61%)
Threonine (Thr, T)
n = 40 (7.74%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.54%)
Leucine (Leu, L)
n = 62 (11.99%)
Isoleucine (Ile, I)
n = 39 (7.54%)
Methionine (Met, M)
n = 27 (5.22%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 41 (7.93%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 16 (3.09%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 17 (3.29%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 18 (3.48%)
Lysine (Lys, K)
n = 11 (2.13%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 15 25 21 3 16 1 21 7 0 18 4 12 5 23 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 15 17 13 0 4 10 26 4 6 5 15 2 16
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 17 2 6 6 12 0 1 4 10 9 0 0 9 8 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 0 6 10 10 1 5 0 2 1 1 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 102 140 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 137 97 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 126 203 171
COX2 (size: 690 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 13 (5.68%)
Serine (Ser, S)
n = 19 (8.3%)
Threonine (Thr, T)
n = 16 (6.99%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 16 (6.99%)
Leucine (Leu, L)
n = 25 (10.92%)
Isoleucine (Ile, I)
n = 22 (9.61%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 13 (5.68%)
Phenylalanine (Phe, F)
n = 9 (3.93%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 8 (3.49%)
Lysine (Lys, K)
n = 3 (1.31%)
Arginine (Arg, R)
n = 7 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 7 9 8 2 10 0 5 7 2 8 1 7 0 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 3 3 7 0 2 3 4 0 4 0 9 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 8 0 6 5 3 0 5 0 6 4 0 0 3 1 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 13 2 8 4 3 0 1 3 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 57 62 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 56 62 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 43 94 86
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.28%)
Alanine (Ala, A)
n = 22 (8.43%)
Serine (Ser, S)
n = 16 (6.13%)
Threonine (Thr, T)
n = 23 (8.81%)
Cysteine (Cys, C)
n = 3 (1.15%)
Valine (Val, V)
n = 18 (6.9%)
Leucine (Leu, L)
n = 35 (13.41%)
Isoleucine (Ile, I)
n = 11 (4.21%)
Methionine (Met, M)
n = 11 (4.21%)
Proline (Pro, P)
n = 11 (4.21%)
Phenylalanine (Phe, F)
n = 20 (7.66%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 4 (1.53%)
Glutamic acid (Glu, E)
n = 9 (3.45%)
Asparagine (Asn, N)
n = 4 (1.53%)
Glutamine (Gln, Q)
n = 7 (2.68%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 4 7 7 1 19 2 5 7 0 7 2 7 2 13 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 4 10 8 0 4 11 4 0 0 3 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 10 0 6 3 2 1 1 3 6 6 0 1 2 2 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 1 2 2 3 0 0 1 4 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 68 56 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 56 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 72 105 74
CYTB (size: 1191 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (7.07%)
Alanine (Ala, A)
n = 31 (7.83%)
Serine (Ser, S)
n = 25 (6.31%)
Threonine (Thr, T)
n = 23 (5.81%)
Cysteine (Cys, C)
n = 3 (0.76%)
Valine (Val, V)
n = 22 (5.56%)
Leucine (Leu, L)
n = 55 (13.89%)
Isoleucine (Ile, I)
n = 38 (9.6%)
Methionine (Met, M)
n = 16 (4.04%)
Proline (Pro, P)
n = 22 (5.56%)
Phenylalanine (Phe, F)
n = 31 (7.83%)
Tyrosine (Tyr, Y)
n = 13 (3.28%)
Tryptophan (Trp, W)
n = 12 (3.03%)
Aspartic acid (Asp, D)
n = 8 (2.02%)
Glutamic acid (Glu, E)
n = 7 (1.77%)
Asparagine (Asn, N)
n = 22 (5.56%)
Glutamine (Gln, Q)
n = 8 (2.02%)
Histidine (His, H)
n = 13 (3.28%)
Lysine (Lys, K)
n = 10 (2.53%)
Arginine (Arg, R)
n = 9 (2.27%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 8 12 11 6 17 3 16 8 0 10 3 7 2 20 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 0 7 12 11 1 5 9 7 7 6 2 14 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 0 10 2 7 2 2 2 8 5 1 2 10 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 3 4 4 8 2 2 2 4 1 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
96 89 114 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 97 81 162
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 95 136 138
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (6.23%)
Alanine (Ala, A)
n = 28 (8.72%)
Serine (Ser, S)
n = 24 (7.48%)
Threonine (Thr, T)
n = 21 (6.54%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 23 (7.17%)
Leucine (Leu, L)
n = 60 (18.69%)
Isoleucine (Ile, I)
n = 22 (6.85%)
Methionine (Met, M)
n = 16 (4.98%)
Proline (Pro, P)
n = 17 (5.3%)
Phenylalanine (Phe, F)
n = 21 (6.54%)
Tyrosine (Tyr, Y)
n = 9 (2.8%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 10 (3.12%)
Asparagine (Asn, N)
n = 13 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.8%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.18%)
Arginine (Arg, R)
n = 7 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 10 12 17 5 12 6 18 8 1 7 2 14 0 16 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 8 6 13 1 4 2 10 4 5 4 8 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 5 1 7 3 10 1 0 3 5 4 0 2 9 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 1 1 2 5 2 0 1 5 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 75 82 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 87 54 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 58 138 102
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.2%)
Alanine (Ala, A)
n = 31 (8.96%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 36 (10.4%)
Cysteine (Cys, C)
n = 4 (1.16%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 61 (17.63%)
Isoleucine (Ile, I)
n = 35 (10.12%)
Methionine (Met, M)
n = 24 (6.94%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 12 (3.47%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 13 20 20 4 19 3 14 12 0 3 0 3 1 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 4 0 12 7 12 0 2 10 3 3 3 3 13 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 19 0 5 1 12 0 2 7 3 3 1 1 10 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 0 2 1 8 2 2 1 1 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 88 131 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 104 59 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 76 149 107
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.2%)
Alanine (Ala, A)
n = 31 (8.96%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 36 (10.4%)
Cysteine (Cys, C)
n = 4 (1.16%)
Valine (Val, V)
n = 7 (2.02%)
Leucine (Leu, L)
n = 61 (17.63%)
Isoleucine (Ile, I)
n = 35 (10.12%)
Methionine (Met, M)
n = 24 (6.94%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 6 (1.73%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 12 (3.47%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.89%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 13 20 20 4 19 3 14 12 0 3 0 3 1 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 4 0 12 7 12 0 2 10 3 3 3 3 13 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 19 0 5 1 12 0 2 7 3 3 1 1 10 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 0 2 1 8 2 2 1 1 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 88 131 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 104 59 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 76 149 107
ND4 (size: 1377 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (3.28%)
Alanine (Ala, A)
n = 35 (7.64%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 41 (8.95%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 82 (17.9%)
Isoleucine (Ile, I)
n = 48 (10.48%)
Methionine (Met, M)
n = 37 (8.08%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 24 (5.24%)
Tyrosine (Tyr, Y)
n = 8 (1.75%)
Tryptophan (Trp, W)
n = 14 (3.06%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 17 (3.71%)
Glutamine (Gln, Q)
n = 9 (1.97%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 12 (2.62%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
32 16 35 19 10 26 2 22 9 0 3 1 2 3 13 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 4 10 17 8 0 1 7 6 1 6 6 11 1 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 18 0 11 3 14 2 2 8 5 3 0 3 9 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 0 0 5 12 0 2 2 5 0 1 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 112 166 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 130 74 200
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 119 193 133
ND4L (size: 291 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.13%)
Alanine (Ala, A)
n = 12 (12.5%)
Serine (Ser, S)
n = 8 (8.33%)
Threonine (Thr, T)
n = 9 (9.38%)
Cysteine (Cys, C)
n = 2 (2.08%)
Valine (Val, V)
n = 1 (1.04%)
Leucine (Leu, L)
n = 26 (27.08%)
Isoleucine (Ile, I)
n = 4 (4.17%)
Methionine (Met, M)
n = 6 (6.25%)
Proline (Pro, P)
n = 3 (3.13%)
Phenylalanine (Phe, F)
n = 4 (4.17%)
Tyrosine (Tyr, Y)
n = 1 (1.04%)
Tryptophan (Trp, W)
n = 1 (1.04%)
Aspartic acid (Asp, D)
n = 1 (1.04%)
Glutamic acid (Glu, E)
n = 2 (2.08%)
Asparagine (Asn, N)
n = 4 (4.17%)
Glutamine (Gln, Q)
n = 2 (2.08%)
Histidine (His, H)
n = 2 (2.08%)
Lysine (Lys, K)
n = 3 (3.13%)
Arginine (Arg, R)
n = 2 (2.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 1 4 6 0 6 3 11 2 0 0 1 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 2 5 5 0 0 2 1 0 0 1 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 3 1 3 0 0 1 1 0 0 0 0 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 3 0 1 0 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 24 27 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 31 16 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 23 47 22
ND5 (size: 1797 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (3.85%)
Alanine (Ala, A)
n = 44 (7.36%)
Serine (Ser, S)
n = 48 (8.03%)
Threonine (Thr, T)
n = 58 (9.7%)
Cysteine (Cys, C)
n = 7 (1.17%)
Valine (Val, V)
n = 13 (2.17%)
Leucine (Leu, L)
n = 92 (15.38%)
Isoleucine (Ile, I)
n = 60 (10.03%)
Methionine (Met, M)
n = 39 (6.52%)
Proline (Pro, P)
n = 29 (4.85%)
Phenylalanine (Phe, F)
n = 34 (5.69%)
Tyrosine (Tyr, Y)
n = 13 (2.17%)
Tryptophan (Trp, W)
n = 14 (2.34%)
Aspartic acid (Asp, D)
n = 10 (1.67%)
Glutamic acid (Glu, E)
n = 14 (2.34%)
Asparagine (Asn, N)
n = 32 (5.35%)
Glutamine (Gln, Q)
n = 18 (3.01%)
Histidine (His, H)
n = 13 (2.17%)
Lysine (Lys, K)
n = 26 (4.35%)
Arginine (Arg, R)
n = 11 (1.84%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
39 21 35 17 11 36 6 20 15 3 5 1 7 0 19 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 4 12 18 13 1 2 6 13 2 3 10 13 3 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 27 2 12 9 12 1 8 6 8 5 1 2 16 16 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 10 4 6 4 24 2 3 2 5 1 0 1 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
104 141 230 124
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 165 126 238
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 151 243 172
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (11.05%)
Alanine (Ala, A)
n = 15 (8.72%)
Serine (Ser, S)
n = 10 (5.81%)
Threonine (Thr, T)
n = 4 (2.33%)
Cysteine (Cys, C)
n = 7 (4.07%)
Valine (Val, V)
n = 28 (16.28%)
Leucine (Leu, L)
n = 28 (16.28%)
Isoleucine (Ile, I)
n = 5 (2.91%)
Methionine (Met, M)
n = 7 (4.07%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 19 (11.05%)
Tyrosine (Tyr, Y)
n = 9 (5.23%)
Tryptophan (Trp, W)
n = 3 (1.74%)
Aspartic acid (Asp, D)
n = 4 (2.33%)
Glutamic acid (Glu, E)
n = 3 (1.74%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 3 3 0 0 2 15 0 0 15 2 6 5 16 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 7 0 11 3 1 0 4 2 3 10 4 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 5 0 2 0 2 1 6 3 2 8 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 3 1 0 0 2 0 1 1 1 0 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 14 22 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 30 19 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
35 17 35 86
Total protein-coding genes (size: 11411 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 211 (5.55%)
Alanine (Ala, A)
n = 306 (8.05%)
Serine (Ser, S)
n = 268 (7.05%)
Threonine (Thr, T)
n = 309 (8.13%)
Cysteine (Cys, C)
n = 38 (1.0%)
Valine (Val, V)
n = 189 (4.97%)
Leucine (Leu, L)
n = 610 (16.04%)
Isoleucine (Ile, I)
n = 320 (8.42%)
Methionine (Met, M)
n = 218 (5.73%)
Proline (Pro, P)
n = 200 (5.26%)
Phenylalanine (Phe, F)
n = 236 (6.21%)
Tyrosine (Tyr, Y)
n = 108 (2.84%)
Tryptophan (Trp, W)
n = 109 (2.87%)
Aspartic acid (Asp, D)
n = 71 (1.87%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 142 (3.73%)
Glutamine (Gln, Q)
n = 98 (2.58%)
Histidine (His, H)
n = 99 (2.6%)
Lysine (Lys, K)
n = 94 (2.47%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
209 111 178 148 50 190 30 171 91 7 80 22 69 18 148 88
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
40 23 15 97 106 99 4 28 66 83 34 43 40 107 10 97
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
72 135 5 80 38 81 8 25 36 63 45 5 21 73 69 36
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
63 79 16 35 36 85 9 18 14 33 6 4 1 4 2 104
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
872 886 1149 896
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
495 1022 713 1573
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
216 871 1513 1203

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.