Viewing data for Fringilla montifringilla


Scientific name Fringilla montifringilla
Common name Brambling
Maximum lifespan 14.80 years (Fringilla montifringilla@AnAge)

Total mtDNA (size: 16807 bases) GC AT G C A T
Base content (bases) 7796 9011 5392 2404 3914 5097
Base content per 1 kb (bases) 464 536 321 143 233 303
Base content (%) 46.4% 53.6%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5391 5987 3951 1440 2622 3365
Base content per 1 kb (bases) 474 526 347 127 230 296
Base content (%) 47.4% 52.6%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1538 bases) GC AT G C A T
Base content (bases) 640 898 369 271 389 509
Base content per 1 kb (bases) 416 584 240 176 253 331
Base content (%) 41.6% 58.4%
Total rRNA-coding genes (size: 2572 bases) GC AT G C A T
Base content (bases) 1192 1380 666 526 535 845
Base content per 1 kb (bases) 463 537 259 205 208 329
Base content (%) 46.3% 53.7%
12S rRNA gene (size: 974 bases) GC AT G C A T
Base content (bases) 478 496 269 209 199 297
Base content per 1 kb (bases) 491 509 276 215 204 305
Base content (%) 49.1% 50.9%
16S rRNA gene (size: 1598 bases) GC AT G C A T
Base content (bases) 714 884 397 317 336 548
Base content per 1 kb (bases) 447 553 248 198 210 343
Base content (%) 44.7% 55.3%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 318 366 254 64 159 207
Base content per 1 kb (bases) 465 535 371 94 232 303
Base content (%) 46.5% 53.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 70 98 59 11 44 54
Base content per 1 kb (bases) 417 583 351 65 262 321
Base content (%) 41.7% 58.3%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 734 817 477 257 378 439
Base content per 1 kb (bases) 473 527 308 166 244 283
Base content (%) 47.3% 52.7%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 340 344 235 105 146 198
Base content per 1 kb (bases) 497 503 344 154 213 289
Base content (%) 49.7% 50.3%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 387 397 265 122 193 204
Base content per 1 kb (bases) 494 506 338 156 246 260
Base content (%) 49.4% 50.6%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 543 600 395 148 277 323
Base content per 1 kb (bases) 475 525 346 129 242 283
Base content (%) 47.5% 52.5%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 482 496 343 139 239 257
Base content per 1 kb (bases) 493 507 351 142 244 263
Base content (%) 49.3% 50.7%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 478 562 366 112 246 316
Base content per 1 kb (bases) 460 540 352 108 237 304
Base content (%) 46.0% 54.0%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 166 185 125 41 87 98
Base content per 1 kb (bases) 473 527 356 117 248 279
Base content (%) 47.3% 52.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 647 731 494 153 311 420
Base content per 1 kb (bases) 470 530 358 111 226 305
Base content (%) 47.0% 53.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 146 151 110 36 68 83
Base content per 1 kb (bases) 492 508 370 121 229 279
Base content (%) 49.2% 50.8%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 835 983 631 204 413 570
Base content per 1 kb (bases) 459 541 347 112 227 314
Base content (%) 45.9% 54.1%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 249 270 199 50 66 204
Base content per 1 kb (bases) 480 520 383 96 127 393
Base content (%) 48.0% 52.0%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 24 (10.57%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 62 (27.31%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 13 8 1 19 37 1 4 8 0 1 3 3 1 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 10 3 1 1 3 4 0 0 8 7 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 12 0 2 6 3 0 0 4 0 3 1 0 0 9 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 4 0 1 2 4 0 0 1 4 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 89 67 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 65 35 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 100 105 18
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFFIMLTSWLTFSLIIQPKLLTFVTMNPPSNKPPIAPSTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 8 (14.55%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 11 (20.0%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 1 1 2 2 0 1 1 1 0 0 1 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 0 0 0 0 0 0 0 5 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 0 0 2 1 0 1 0 0 0 0 0 2 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 18 22 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 23 9 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 18 23 12
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 42 (8.14%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 37 (7.17%)
Methionine (Met, M)
n = 22 (4.26%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 30 15 8 12 35 4 4 9 0 5 14 19 4 8 35
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 6 20 19 0 5 11 31 0 3 12 14 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 19 2 4 8 12 0 0 4 3 14 0 0 4 11 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 1 3 12 9 0 1 1 6 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
159 125 127 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 138 94 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 214 218 65
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 22 (9.69%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 18 (7.93%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 14 (6.17%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 12 (5.29%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 10 7 4 11 13 2 1 6 0 3 9 4 2 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 3 9 4 0 0 2 6 0 2 4 6 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 6 0 1 8 7 0 0 6 0 7 0 0 0 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 2 0 13 4 0 1 2 3 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 63 57 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 60 58 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 112 83 23
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 18 (6.92%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 14 (5.38%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 13 4 0 11 21 1 1 7 0 3 7 7 0 5 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 4 12 7 0 2 4 12 1 4 5 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 7 0 3 7 3 0 0 5 3 8 0 0 1 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 5 2 1 4 3 1 0 3 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 76 53 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 121 97 35
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 28 (7.37%)
Serine (Ser, S)
n = 23 (6.05%)
Threonine (Thr, T)
n = 25 (6.58%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 22 (5.79%)
Leucine (Leu, L)
n = 63 (16.58%)
Isoleucine (Ile, I)
n = 35 (9.21%)
Methionine (Met, M)
n = 8 (2.11%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 26 (6.84%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 20 (5.26%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 27 5 7 14 41 1 0 8 0 2 12 7 1 2 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 3 4 16 8 0 2 9 12 1 7 9 8 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 12 0 1 9 11 1 0 1 1 12 0 0 3 17 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 1 2 7 8 2 1 1 6 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
90 115 99 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 99 80 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 181 144 46
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (4.0%)
Alanine (Ala, A)
n = 31 (9.54%)
Serine (Ser, S)
n = 25 (7.69%)
Threonine (Thr, T)
n = 19 (5.85%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 17 (5.23%)
Leucine (Leu, L)
n = 64 (19.69%)
Isoleucine (Ile, I)
n = 23 (7.08%)
Methionine (Met, M)
n = 11 (3.38%)
Proline (Pro, P)
n = 25 (7.69%)
Phenylalanine (Phe, F)
n = 19 (5.85%)
Tyrosine (Tyr, Y)
n = 15 (4.62%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 14 (4.31%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 16 6 4 18 31 7 4 5 1 2 5 10 0 2 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 4 15 9 3 0 7 5 1 6 10 8 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 7 0 1 12 6 0 0 6 3 12 1 0 2 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 3 2 2 6 1 2 1 5 0 0 1 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 101 81 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 94 59 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 148 117 37
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 31 (8.99%)
Serine (Ser, S)
n = 29 (8.41%)
Threonine (Thr, T)
n = 40 (11.59%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 31 (8.99%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 27 15 8 22 25 8 3 8 2 2 4 4 0 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 6 12 12 1 0 6 6 1 6 5 10 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 14 0 7 7 10 0 1 4 1 6 0 0 1 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 3 1 1 1 12 2 0 1 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 108 121 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 116 59 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 142 135 50
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 31 (8.99%)
Serine (Ser, S)
n = 29 (8.41%)
Threonine (Thr, T)
n = 40 (11.59%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 10 (2.9%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 31 (8.99%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 27 15 8 22 25 8 3 8 2 2 4 4 0 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 0 6 12 12 1 0 6 6 1 6 5 10 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 14 0 7 7 10 0 1 4 1 6 0 0 1 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 3 1 1 1 12 2 0 1 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 108 121 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 116 59 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 142 135 50
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 39 (8.52%)
Serine (Ser, S)
n = 38 (8.3%)
Threonine (Thr, T)
n = 39 (8.52%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 97 (21.18%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 26 (5.68%)
Proline (Pro, P)
n = 31 (6.77%)
Phenylalanine (Phe, F)
n = 13 (2.84%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 13 (2.84%)
Histidine (His, H)
n = 12 (2.62%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 12 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 33 22 4 20 55 10 8 12 1 1 3 9 0 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 3 8 21 10 0 1 7 9 0 0 17 13 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 13 1 6 13 10 0 1 8 1 13 0 0 1 15 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 0 0 3 10 0 0 3 9 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 157 140 80
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 138 78 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 199 202 41
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 13 (13.27%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 7 (7.14%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 4 0 2 15 1 1 2 0 0 1 1 0 0 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 1 7 2 0 0 2 2 0 0 1 2 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 2 4 4 0 0 3 0 3 0 0 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 2 0 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 32 24 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 30 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 48 41 6
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 45 (7.44%)
Serine (Ser, S)
n = 51 (8.43%)
Threonine (Thr, T)
n = 66 (10.91%)
Cysteine (Cys, C)
n = 7 (1.16%)
Valine (Val, V)
n = 17 (2.81%)
Leucine (Leu, L)
n = 100 (16.53%)
Isoleucine (Ile, I)
n = 56 (9.26%)
Methionine (Met, M)
n = 32 (5.29%)
Proline (Pro, P)
n = 28 (4.63%)
Phenylalanine (Phe, F)
n = 40 (6.61%)
Tyrosine (Tyr, Y)
n = 12 (1.98%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 13 (2.15%)
Asparagine (Asn, N)
n = 26 (4.3%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 48 29 4 23 60 4 9 15 2 2 7 7 1 4 36
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 4 3 27 14 1 3 13 16 1 6 9 12 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
40 22 0 3 19 18 2 0 9 0 12 1 0 4 22 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 12 1 0 8 19 1 0 3 5 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
116 158 210 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 181 110 245
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 292 250 46
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (18.02%)
Alanine (Ala, A)
n = 11 (6.4%)
Serine (Ser, S)
n = 13 (7.56%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 34 (19.77%)
Leucine (Leu, L)
n = 30 (17.44%)
Isoleucine (Ile, I)
n = 3 (1.74%)
Methionine (Met, M)
n = 8 (4.65%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 8 (4.65%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 5 (2.91%)
Asparagine (Asn, N)
n = 3 (1.74%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 3 5 0 2 3 5 0 0 15 2 3 14 8 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 5 0 2 4 7 1 7 16 2 0 0 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 5 1 3 2 2 0 7 0 1 15 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 4 3 0 0 0 0 0 0 4 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 18 18 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 28 19 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
72 4 29 68
Total protein-coding genes (size: 11395 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 222 (5.85%)
Alanine (Ala, A)
n = 301 (7.93%)
Serine (Ser, S)
n = 287 (7.56%)
Threonine (Thr, T)
n = 312 (8.22%)
Cysteine (Cys, C)
n = 30 (0.79%)
Valine (Val, V)
n = 202 (5.32%)
Leucine (Leu, L)
n = 663 (17.47%)
Isoleucine (Ile, I)
n = 290 (7.64%)
Methionine (Met, M)
n = 168 (4.43%)
Proline (Pro, P)
n = 227 (5.98%)
Phenylalanine (Phe, F)
n = 220 (5.8%)
Tyrosine (Tyr, Y)
n = 111 (2.92%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 69 (1.82%)
Glutamic acid (Glu, E)
n = 91 (2.4%)
Asparagine (Asn, N)
n = 134 (3.53%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 104 (2.74%)
Lysine (Lys, K)
n = 85 (2.24%)
Arginine (Arg, R)
n = 73 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
58 232 123 47 161 352 44 44 84 8 36 67 76 23 42 178
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
45 8 22 45 156 90 10 22 65 113 22 37 88 95 7 36
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
155 117 4 35 102 89 5 5 51 19 92 4 15 23 111 24
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
80 76 15 13 56 78 7 5 17 47 4 1 2 6 1 102
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
885 1100 1048 764
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
490 1071 693 1543
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
216 1633 1493 455

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.