Viewing data for Clupeonella cultriventris


Scientific name Clupeonella cultriventris
Common name Black sea sprat
Maximum lifespan 5.00 years (Clupeonella cultriventris@AnAge)

Total mtDNA (size: 16650 bases) GC AT G C A T
Base content (bases) 7865 8785 4653 3212 4435 4350
Base content per 1 kb (bases) 472 528 279 193 266 261
Base content (%) 47.2% 52.8%
Total protein-coding genes (size: 11403 bases) GC AT G C A T
Base content (bases) 5398 6005 3332 2066 3232 2773
Base content per 1 kb (bases) 473 527 292 181 283 243
Base content (%) 47.3% 52.7%
D-loop (size: 1004 bases) GC AT G C A T
Base content (bases) 389 615 213 176 305 310
Base content per 1 kb (bases) 387 613 212 175 304 309
Base content (%) 38.7% 61.3%
Total tRNA-coding genes (size: 1550 bases) GC AT G C A T
Base content (bases) 740 810 399 341 370 440
Base content per 1 kb (bases) 477 523 257 220 239 284
Base content (%) 47.7% 52.3%
Total rRNA-coding genes (size: 2631 bases) GC AT G C A T
Base content (bases) 1300 1331 689 611 518 813
Base content per 1 kb (bases) 494 506 262 232 197 309
Base content (%) 49.4% 50.6%
12S rRNA gene (size: 951 bases) GC AT G C A T
Base content (bases) 482 469 256 226 194 275
Base content per 1 kb (bases) 507 493 269 238 204 289
Base content (%) 50.7% 49.3%
16S rRNA gene (size: 1680 bases) GC AT G C A T
Base content (bases) 818 862 433 385 324 538
Base content per 1 kb (bases) 487 513 258 229 193 320
Base content (%) 48.7% 51.3%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 311 373 204 107 203 170
Base content per 1 kb (bases) 455 545 298 156 297 249
Base content (%) 45.5% 54.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 73 95 49 24 46 49
Base content per 1 kb (bases) 435 565 292 143 274 292
Base content (%) 43.5% 56.5%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 709 842 409 300 463 379
Base content per 1 kb (bases) 457 543 264 193 299 244
Base content (%) 45.7% 54.3%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 303 388 183 120 198 190
Base content per 1 kb (bases) 438 562 265 174 287 275
Base content (%) 43.8% 56.2%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 389 396 240 149 218 178
Base content per 1 kb (bases) 496 504 306 190 278 227
Base content (%) 49.6% 50.4%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 533 608 330 203 355 253
Base content per 1 kb (bases) 467 533 289 178 311 222
Base content (%) 46.7% 53.3%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 490 485 294 196 285 200
Base content per 1 kb (bases) 503 497 302 201 292 205
Base content (%) 50.3% 49.7%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 526 519 346 180 275 244
Base content per 1 kb (bases) 503 497 331 172 263 233
Base content (%) 50.3% 49.7%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 167 182 101 66 108 74
Base content per 1 kb (bases) 479 521 289 189 309 212
Base content (%) 47.9% 52.1%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 670 711 400 270 403 308
Base content per 1 kb (bases) 485 515 290 196 292 223
Base content (%) 48.5% 51.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 148 149 93 55 82 67
Base content per 1 kb (bases) 498 502 313 185 276 226
Base content (%) 49.8% 50.2%
ND5 (size: 1836 bases) GC AT G C A T
Base content (bases) 837 999 532 305 519 480
Base content per 1 kb (bases) 456 544 290 166 283 261
Base content (%) 45.6% 54.4%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 246 276 153 93 84 192
Base content per 1 kb (bases) 471 529 293 178 161 368
Base content (%) 47.1% 52.9%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (5.29%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 7 (3.08%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 49 (21.59%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 18 (7.93%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 5 (2.2%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 2 2 13 12 14 5 5 6 3 7 3 5 1 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 0 4 4 9 1 3 3 3 3 6 7 4 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 9 1 1 1 1 0 0 4 2 3 0 0 2 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 0 1 1 0 0 1 2 3 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 81 66 30
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 61 34 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 62 70 67
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFAILVFSWLIFLTVIPPKVLAHNFNNEPTTVGAEKAKPEPWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 1 (1.82%)
Threonine (Thr, T)
n = 3 (5.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (7.27%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 0 1 0 0 1 2 1 0 0 2 1 1 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 2 1 0 0 0 1 0 5 3 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 0 1 0 0 0 0 0 1 1 1 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 0 0 0 3 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
13 13 15 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 18 15 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 18 19 14
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.91%)
Alanine (Ala, A)
n = 47 (9.11%)
Serine (Ser, S)
n = 31 (6.01%)
Threonine (Thr, T)
n = 35 (6.78%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 42 (8.14%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 39 (7.56%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 18 6 21 18 14 6 1 5 3 14 10 15 3 17 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
19 0 1 12 12 20 3 4 6 22 14 9 8 10 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 17 3 7 7 10 2 2 3 8 10 3 2 9 5 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 3 7 7 8 1 1 0 7 0 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
160 122 127 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 136 94 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
63 151 158 145
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 17 (7.42%)
Serine (Ser, S)
n = 15 (6.55%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 21 (9.17%)
Leucine (Leu, L)
n = 29 (12.66%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 16 (6.99%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 7 6 10 4 6 3 6 7 1 8 5 8 0 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 4 7 3 3 1 2 6 0 4 5 4 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 3 1 4 5 3 0 1 2 4 5 0 0 1 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 14 2 3 9 2 2 3 1 1 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 61 52 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 53 64 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 69 74 67
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (8.85%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 11 (4.23%)
Methionine (Met, M)
n = 6 (2.31%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 3 2 10 10 8 4 1 5 3 5 5 7 1 6 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 2 9 8 1 5 4 8 6 2 6 3 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 1 5 4 3 0 3 1 2 9 3 1 1 1 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 6 3 0 5 2 0 0 0 5 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 73 49 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 68 53 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 99 75 59
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (7.12%)
Alanine (Ala, A)
n = 32 (8.44%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 20 (5.28%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 32 (8.44%)
Leucine (Leu, L)
n = 61 (16.09%)
Isoleucine (Ile, I)
n = 27 (7.12%)
Methionine (Met, M)
n = 7 (1.85%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 10 1 21 13 15 7 3 4 2 9 11 10 2 11 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 3 1 6 15 10 1 5 7 10 5 5 7 8 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 4 2 8 5 5 3 0 1 5 9 2 2 10 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 2 4 7 5 4 0 1 5 2 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
109 103 81 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 94 76 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 133 96 110
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.86%)
Alanine (Ala, A)
n = 38 (11.73%)
Serine (Ser, S)
n = 20 (6.17%)
Threonine (Thr, T)
n = 19 (5.86%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 20 (6.17%)
Leucine (Leu, L)
n = 58 (17.9%)
Isoleucine (Ile, I)
n = 22 (6.79%)
Methionine (Met, M)
n = 11 (3.4%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 21 (6.48%)
Tyrosine (Tyr, Y)
n = 12 (3.7%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 10 (3.09%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 6 2 15 14 10 14 2 5 1 8 4 6 2 10 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 0 3 17 10 8 2 5 5 7 7 8 7 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 2 2 4 7 5 1 1 2 8 4 2 3 4 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 6 3 1 3 4 0 1 4 3 0 0 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
92 96 72 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 98 56 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
65 100 72 88
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 50 (14.41%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 44 (12.68%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 11 (3.17%)
Leucine (Leu, L)
n = 68 (19.6%)
Isoleucine (Ile, I)
n = 25 (7.2%)
Methionine (Met, M)
n = 13 (3.75%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 7 (2.02%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 8 3 18 17 11 10 8 9 5 5 3 2 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 2 7 27 10 6 3 3 8 2 4 8 3 3 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 14 4 5 10 4 0 0 4 3 5 6 4 5 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 2 1 0 5 5 0 2 1 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 100 103 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 131 54 126
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
59 115 87 87
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 50 (14.41%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 44 (12.68%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 11 (3.17%)
Leucine (Leu, L)
n = 68 (19.6%)
Isoleucine (Ile, I)
n = 25 (7.2%)
Methionine (Met, M)
n = 13 (3.75%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 7 (2.02%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 8 3 18 17 11 10 8 9 5 5 3 2 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 2 7 27 10 6 3 3 8 2 4 8 3 3 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 14 4 5 10 4 0 0 4 3 5 6 4 5 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 2 1 0 5 5 0 2 1 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 100 103 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 131 54 126
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
59 115 87 87
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (6.54%)
Alanine (Ala, A)
n = 46 (10.02%)
Serine (Ser, S)
n = 29 (6.32%)
Threonine (Thr, T)
n = 37 (8.06%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 23 (5.01%)
Leucine (Leu, L)
n = 86 (18.74%)
Isoleucine (Ile, I)
n = 35 (7.63%)
Methionine (Met, M)
n = 23 (5.01%)
Proline (Pro, P)
n = 26 (5.66%)
Phenylalanine (Phe, F)
n = 18 (3.92%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 11 (2.4%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 10 5 28 15 21 9 9 7 3 8 8 4 3 6 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
18 2 2 13 17 14 2 1 10 10 9 7 8 7 4 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 10 2 5 10 4 3 2 5 6 8 11 4 6 5 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 7 0 4 4 6 3 1 6 2 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
114 132 123 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 131 71 185
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
83 137 114 126
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 13 (13.27%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 25 (25.51%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 4 (4.08%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 1 9 3 8 2 2 2 1 1 0 1 0 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 0 6 7 0 0 4 0 1 0 1 0 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 5 1 1 1 3 0 1 3 0 0 0 1 1 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 0 3 0 1 0 0 0 0 1 2 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 34 21 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 30 14 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 29 32 23
ND5 (size: 1836 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.4%)
Alanine (Ala, A)
n = 58 (9.49%)
Serine (Ser, S)
n = 44 (7.2%)
Threonine (Thr, T)
n = 61 (9.98%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 32 (5.24%)
Leucine (Leu, L)
n = 87 (14.24%)
Isoleucine (Ile, I)
n = 52 (8.51%)
Methionine (Met, M)
n = 29 (4.75%)
Proline (Pro, P)
n = 29 (4.75%)
Phenylalanine (Phe, F)
n = 40 (6.55%)
Tyrosine (Tyr, Y)
n = 12 (1.96%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 15 (2.45%)
Glutamic acid (Glu, E)
n = 10 (1.64%)
Asparagine (Asn, N)
n = 26 (4.26%)
Glutamine (Gln, Q)
n = 20 (3.27%)
Histidine (His, H)
n = 13 (2.13%)
Lysine (Lys, K)
n = 20 (3.27%)
Arginine (Arg, R)
n = 10 (1.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 18 10 26 12 25 12 8 14 6 9 11 11 1 19 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
19 2 4 12 29 14 3 4 6 10 13 6 14 9 0 17
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 15 4 7 12 12 0 2 11 4 8 6 4 12 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 3 6 9 12 8 1 1 6 2 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 147 201 116
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 179 117 240
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
81 206 162 163
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (13.29%)
Alanine (Ala, A)
n = 21 (12.14%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 21 (12.14%)
Leucine (Leu, L)
n = 33 (19.08%)
Isoleucine (Ile, I)
n = 1 (0.58%)
Methionine (Met, M)
n = 8 (4.62%)
Proline (Pro, P)
n = 6 (3.47%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.16%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 5 3 2 7 7 8 0 0 7 1 8 5 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 0 12 3 4 2 4 3 7 9 3 2 0 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 0 0 5 0 1 2 2 1 5 2 2 6 1 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 3 2 0 1 1 0 2 1 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 31 19 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 39 21 77
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 23 44 64
Total protein-coding genes (size: 11425 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 250 (6.57%)
Alanine (Ala, A)
n = 374 (9.83%)
Serine (Ser, S)
n = 236 (6.2%)
Threonine (Thr, T)
n = 293 (7.7%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 249 (6.54%)
Leucine (Leu, L)
n = 625 (16.43%)
Isoleucine (Ile, I)
n = 261 (6.86%)
Methionine (Met, M)
n = 155 (4.07%)
Proline (Pro, P)
n = 215 (5.65%)
Phenylalanine (Phe, F)
n = 236 (6.2%)
Tyrosine (Tyr, Y)
n = 113 (2.97%)
Tryptophan (Trp, W)
n = 120 (3.15%)
Aspartic acid (Asp, D)
n = 77 (2.02%)
Glutamic acid (Glu, E)
n = 100 (2.63%)
Asparagine (Asn, N)
n = 112 (2.94%)
Glutamine (Gln, Q)
n = 96 (2.52%)
Histidine (His, H)
n = 105 (2.76%)
Lysine (Lys, K)
n = 77 (2.02%)
Arginine (Arg, R)
n = 76 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
174 87 45 179 128 147 86 57 67 29 84 66 79 20 101 135
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
110 16 13 78 152 114 30 32 57 92 69 59 79 58 19 80
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
102 89 22 54 64 52 14 15 37 48 65 36 28 54 58 30
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
75 62 38 27 50 46 31 10 8 41 17 0 0 5 2 84
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1050 1032 950 774
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
527 1066 687 1526
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
551 1176 1038 1041

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.