Viewing data for Potamalosa richmondia


Scientific name Potamalosa richmondia
Common name Australian freshwater herring
Maximum lifespan 11.00 years (Potamalosa richmondia@AnAge)

Total mtDNA (size: 16681 bases) GC AT G C A T
Base content (bases) 7554 9127 4762 2792 4233 4894
Base content per 1 kb (bases) 453 547 285 167 254 293
Base content (%) 45.3% 54.7%
Total protein-coding genes (size: 11408 bases) GC AT G C A T
Base content (bases) 5144 6264 3401 1743 3023 3241
Base content per 1 kb (bases) 451 549 298 153 265 284
Base content (%) 45.1% 54.9%
D-loop (size: 1033 bases) GC AT G C A T
Base content (bases) 357 676 215 142 335 341
Base content per 1 kb (bases) 346 654 208 137 324 330
Base content (%) 34.6% 65.4%
Total tRNA-coding genes (size: 1554 bases) GC AT G C A T
Base content (bases) 743 811 416 327 357 454
Base content per 1 kb (bases) 478 522 268 210 230 292
Base content (%) 47.8% 52.2%
Total rRNA-coding genes (size: 2632 bases) GC AT G C A T
Base content (bases) 1281 1351 712 569 508 843
Base content per 1 kb (bases) 487 513 271 216 193 320
Base content (%) 48.7% 51.3%
12S rRNA gene (size: 952 bases) GC AT G C A T
Base content (bases) 477 475 267 210 185 290
Base content per 1 kb (bases) 501 499 280 221 194 305
Base content (%) 50.1% 49.9%
16S rRNA gene (size: 1680 bases) GC AT G C A T
Base content (bases) 804 876 445 359 323 553
Base content per 1 kb (bases) 479 521 265 214 192 329
Base content (%) 47.9% 52.1%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 309 375 214 95 198 177
Base content per 1 kb (bases) 452 548 313 139 289 259
Base content (%) 45.2% 54.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 69 99 49 20 45 54
Base content per 1 kb (bases) 411 589 292 119 268 321
Base content (%) 41.1% 58.9%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 696 855 406 290 463 392
Base content per 1 kb (bases) 449 551 262 187 299 253
Base content (%) 44.9% 55.1%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 303 388 190 113 184 204
Base content per 1 kb (bases) 438 562 275 164 266 295
Base content (%) 43.8% 56.2%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 375 411 243 132 198 213
Base content per 1 kb (bases) 477 523 309 168 252 271
Base content (%) 47.7% 52.3%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 509 632 327 182 321 311
Base content per 1 kb (bases) 446 554 287 160 281 273
Base content (%) 44.6% 55.4%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 442 533 293 149 279 254
Base content per 1 kb (bases) 453 547 301 153 286 261
Base content (%) 45.3% 54.7%
ND2 (size: 1047 bases) GC AT G C A T
Base content (bases) 490 557 354 136 241 316
Base content per 1 kb (bases) 468 532 338 130 230 302
Base content (%) 46.8% 53.2%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 153 198 98 55 113 85
Base content per 1 kb (bases) 436 564 279 157 322 242
Base content (%) 43.6% 56.4%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 610 771 406 204 366 405
Base content per 1 kb (bases) 442 558 294 148 265 293
Base content (%) 44.2% 55.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 152 145 103 49 72 73
Base content per 1 kb (bases) 512 488 347 165 242 246
Base content (%) 51.2% 48.8%
ND5 (size: 1836 bases) GC AT G C A T
Base content (bases) 802 1034 549 253 473 561
Base content per 1 kb (bases) 437 563 299 138 258 306
Base content (%) 43.7% 56.3%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 239 283 172 67 76 207
Base content per 1 kb (bases) 458 542 330 128 146 397
Base content (%) 45.8% 54.2%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.85%)
Alanine (Ala, A)
n = 20 (8.81%)
Serine (Ser, S)
n = 7 (3.08%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (6.61%)
Leucine (Leu, L)
n = 49 (21.59%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 18 (7.93%)
Phenylalanine (Phe, F)
n = 12 (5.29%)
Tyrosine (Tyr, Y)
n = 5 (2.2%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 9 (3.96%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 6 7 17 10 15 4 2 5 4 7 4 2 2 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 4 7 9 0 2 2 6 1 3 7 7 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 8 0 0 1 2 0 0 4 1 4 0 1 3 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 1 0 1 0 4 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 82 66 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 63 33 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 69 78 63
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFAILVFSWLVFLTVLPPKILAHKFNNEPTTIGAEKAKPEPWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 1 (1.82%)
Threonine (Thr, T)
n = 3 (5.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 1 (1.82%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 0 1 1 2 0 2 1 0 1 2 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 2 1 0 0 0 1 0 3 4 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 0 1 0 0 0 0 0 0 1 0 0 2 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 0 0 0 3 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
12 15 15 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 18 15 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 16 24 14
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.91%)
Alanine (Ala, A)
n = 50 (9.69%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 36 (6.98%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 42 (8.14%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 12 9 16 14 18 2 12 7 1 10 8 19 5 25 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
16 0 1 12 19 14 5 4 10 14 18 10 3 15 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 14 0 7 8 7 0 1 4 5 13 0 0 3 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 9 2 6 8 9 0 1 0 6 1 0 0 1 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
163 113 127 114
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 136 94 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 157 171 139
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 16 (6.99%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 9 (3.93%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 20 (8.73%)
Leucine (Leu, L)
n = 29 (12.66%)
Isoleucine (Ile, I)
n = 19 (8.3%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 15 (6.55%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 6 10 6 6 11 2 3 8 0 3 6 9 2 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 2 6 6 2 2 2 3 2 6 2 5 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 0 1 8 3 2 0 3 4 5 0 1 2 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 15 0 2 11 3 1 1 1 4 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 63 52 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 53 64 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 74 88 53
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (8.43%)
Alanine (Ala, A)
n = 21 (8.05%)
Serine (Ser, S)
n = 14 (5.36%)
Threonine (Thr, T)
n = 24 (9.2%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.51%)
Leucine (Leu, L)
n = 32 (12.26%)
Isoleucine (Ile, I)
n = 14 (5.36%)
Methionine (Met, M)
n = 7 (2.68%)
Proline (Pro, P)
n = 13 (4.98%)
Phenylalanine (Phe, F)
n = 24 (9.2%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.45%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 8 (3.07%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 8 5 5 4 13 4 6 8 0 5 5 7 0 8 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 0 10 11 0 0 8 8 6 1 6 5 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 0 1 4 6 0 1 2 1 11 1 0 0 2 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 9 0 0 5 2 0 0 1 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 68 52 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 69 55 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 106 106 36
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 36 (9.5%)
Serine (Ser, S)
n = 21 (5.54%)
Threonine (Thr, T)
n = 21 (5.54%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 31 (8.18%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 25 (6.6%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 10 7 9 9 23 5 12 6 0 6 13 11 1 12 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 3 16 16 1 1 3 18 4 2 12 6 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 10 1 3 6 11 0 0 1 8 6 1 1 2 16 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 2 4 7 8 1 1 1 6 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
111 93 83 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 98 77 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 136 151 73
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.86%)
Alanine (Ala, A)
n = 35 (10.8%)
Serine (Ser, S)
n = 21 (6.48%)
Threonine (Thr, T)
n = 23 (7.1%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 19 (5.86%)
Leucine (Leu, L)
n = 63 (19.44%)
Isoleucine (Ile, I)
n = 20 (6.17%)
Methionine (Met, M)
n = 9 (2.78%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 20 (6.17%)
Tyrosine (Tyr, Y)
n = 11 (3.4%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 10 (3.09%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 6 (1.85%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 10 6 9 8 26 6 10 5 1 4 5 9 1 12 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 16 16 0 2 9 6 2 7 11 5 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 1 7 6 6 0 0 2 7 4 1 4 6 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 11 0 2 2 4 3 0 0 7 1 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 93 71 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 101 56 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 99 127 75
ND2 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.6%)
Alanine (Ala, A)
n = 44 (12.64%)
Serine (Ser, S)
n = 18 (5.17%)
Threonine (Thr, T)
n = 52 (14.94%)
Cysteine (Cys, C)
n = 2 (0.57%)
Valine (Val, V)
n = 11 (3.16%)
Leucine (Leu, L)
n = 66 (18.97%)
Isoleucine (Ile, I)
n = 24 (6.9%)
Methionine (Met, M)
n = 18 (5.17%)
Proline (Pro, P)
n = 19 (5.46%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.3%)
Tryptophan (Trp, W)
n = 11 (3.16%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 10 (2.87%)
Glutamine (Gln, Q)
n = 14 (4.02%)
Histidine (His, H)
n = 8 (2.3%)
Lysine (Lys, K)
n = 7 (2.01%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 12 13 7 13 33 3 9 13 1 0 5 6 0 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 7 22 15 0 0 5 8 3 5 4 10 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
27 9 2 2 5 5 0 1 5 1 7 0 1 4 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 1 0 1 6 1 1 0 3 1 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 102 117 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 127 54 128
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 125 145 60
ND3 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.6%)
Alanine (Ala, A)
n = 44 (12.64%)
Serine (Ser, S)
n = 18 (5.17%)
Threonine (Thr, T)
n = 52 (14.94%)
Cysteine (Cys, C)
n = 2 (0.57%)
Valine (Val, V)
n = 11 (3.16%)
Leucine (Leu, L)
n = 66 (18.97%)
Isoleucine (Ile, I)
n = 24 (6.9%)
Methionine (Met, M)
n = 18 (5.17%)
Proline (Pro, P)
n = 19 (5.46%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 8 (2.3%)
Tryptophan (Trp, W)
n = 11 (3.16%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 10 (2.87%)
Glutamine (Gln, Q)
n = 14 (4.02%)
Histidine (His, H)
n = 8 (2.3%)
Lysine (Lys, K)
n = 7 (2.01%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 12 13 7 13 33 3 9 13 1 0 5 6 0 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 7 22 15 0 0 5 8 3 5 4 10 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
27 9 2 2 5 5 0 1 5 1 7 0 1 4 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 1 0 1 6 1 1 0 3 1 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 102 117 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 127 54 128
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 125 145 60
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (6.54%)
Alanine (Ala, A)
n = 40 (8.71%)
Serine (Ser, S)
n = 27 (5.88%)
Threonine (Thr, T)
n = 44 (9.59%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 18 (3.92%)
Leucine (Leu, L)
n = 86 (18.74%)
Isoleucine (Ile, I)
n = 37 (8.06%)
Methionine (Met, M)
n = 26 (5.66%)
Proline (Pro, P)
n = 27 (5.88%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 15 (3.27%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 13 (2.83%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 18 17 17 14 28 5 20 11 0 5 5 8 0 6 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 3 4 15 21 0 3 10 13 4 6 14 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 20 2 5 8 4 1 1 8 3 12 2 2 7 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 0 1 2 9 1 2 2 5 2 0 0 0 0 18
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
102 124 139 95
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 129 74 183
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 153 192 87
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 14 (14.29%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 1 (1.02%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 1 (1.02%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 2 5 2 9 7 2 3 3 0 0 0 1 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 1 6 6 1 1 4 0 0 0 0 1 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 4 0 2 2 0 1 2 3 1 0 1 0 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 1 0 0 0 1 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 32 23 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 29 14 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 42 36 13
ND5 (size: 1836 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.24%)
Alanine (Ala, A)
n = 57 (9.33%)
Serine (Ser, S)
n = 44 (7.2%)
Threonine (Thr, T)
n = 64 (10.47%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 26 (4.26%)
Leucine (Leu, L)
n = 84 (13.75%)
Isoleucine (Ile, I)
n = 53 (8.67%)
Methionine (Met, M)
n = 33 (5.4%)
Proline (Pro, P)
n = 30 (4.91%)
Phenylalanine (Phe, F)
n = 39 (6.38%)
Tyrosine (Tyr, Y)
n = 13 (2.13%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 14 (2.29%)
Glutamic acid (Glu, E)
n = 11 (1.8%)
Asparagine (Asn, N)
n = 28 (4.58%)
Glutamine (Gln, Q)
n = 20 (3.27%)
Histidine (His, H)
n = 12 (1.96%)
Lysine (Lys, K)
n = 21 (3.44%)
Arginine (Arg, R)
n = 10 (1.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 29 23 18 19 26 6 11 19 1 7 10 8 1 16 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 3 3 8 23 24 2 1 10 17 4 8 13 8 1 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 27 2 2 11 17 2 2 10 3 10 3 4 3 25 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 0 7 7 19 2 0 1 8 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
140 141 211 120
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 183 120 235
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 225 230 118
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (13.29%)
Alanine (Ala, A)
n = 21 (12.14%)
Serine (Ser, S)
n = 13 (7.51%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 25 (14.45%)
Leucine (Leu, L)
n = 32 (18.5%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 7 (4.05%)
Proline (Pro, P)
n = 5 (2.89%)
Phenylalanine (Phe, F)
n = 9 (5.2%)
Tyrosine (Tyr, Y)
n = 10 (5.78%)
Tryptophan (Trp, W)
n = 4 (2.31%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 6 (3.47%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 4 3 0 3 1 10 0 0 11 5 6 3 8 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 0 14 0 3 4 5 0 2 16 4 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 4 1 0 4 3 1 7 3 1 15 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 5 3 0 0 1 0 0 3 1 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 17 18 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 38 23 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
56 12 35 71
Total protein-coding genes (size: 11430 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 246 (6.46%)
Alanine (Ala, A)
n = 367 (9.64%)
Serine (Ser, S)
n = 228 (5.99%)
Threonine (Thr, T)
n = 314 (8.25%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 234 (6.14%)
Leucine (Leu, L)
n = 621 (16.31%)
Isoleucine (Ile, I)
n = 264 (6.93%)
Methionine (Met, M)
n = 169 (4.44%)
Proline (Pro, P)
n = 218 (5.72%)
Phenylalanine (Phe, F)
n = 227 (5.96%)
Tyrosine (Tyr, Y)
n = 119 (3.13%)
Tryptophan (Trp, W)
n = 120 (3.15%)
Aspartic acid (Asp, D)
n = 74 (1.94%)
Glutamic acid (Glu, E)
n = 102 (2.68%)
Asparagine (Asn, N)
n = 117 (3.07%)
Glutamine (Gln, Q)
n = 97 (2.55%)
Histidine (His, H)
n = 103 (2.7%)
Lysine (Lys, K)
n = 76 (2.0%)
Arginine (Arg, R)
n = 76 (2.0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
145 119 109 123 110 213 42 103 89 8 60 69 89 16 110 117
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
60 8 19 61 146 145 15 22 64 100 60 57 81 73 7 65
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
121 119 9 36 63 64 10 11 44 42 77 10 30 34 83 27
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
76 90 12 25 49 64 12 7 7 53 9 0 0 7 3 110
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1023 982 995 809
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
524 1072 698 1515
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
303 1245 1428 833

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.