Viewing data for Acridotheres cristatellus


Scientific name Acridotheres cristatellus
Common name Crested myna
Maximum lifespan 13.00 years (Acridotheres cristatellus@AnAge)

Total mtDNA (size: 16820 bases) GC AT G C A T
Base content (bases) 8016 8804 5467 2549 3807 4997
Base content per 1 kb (bases) 477 523 325 152 226 297
Base content (%) 47.7% 52.3%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5561 5817 3985 1576 2523 3294
Base content per 1 kb (bases) 489 511 350 139 222 290
Base content (%) 48.9% 51.1%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1539 bases) GC AT G C A T
Base content (bases) 657 882 384 273 383 499
Base content per 1 kb (bases) 427 573 250 177 249 324
Base content (%) 42.7% 57.3%
Total rRNA-coding genes (size: 2577 bases) GC AT G C A T
Base content (bases) 1203 1374 668 535 537 837
Base content per 1 kb (bases) 467 533 259 208 208 325
Base content (%) 46.7% 53.3%
12S rRNA gene (size: 979 bases) GC AT G C A T
Base content (bases) 480 499 269 211 202 297
Base content per 1 kb (bases) 490 510 275 216 206 303
Base content (%) 49.0% 51.0%
16S rRNA gene (size: 1598 bases) GC AT G C A T
Base content (bases) 723 875 399 324 335 540
Base content per 1 kb (bases) 452 548 250 203 210 338
Base content (%) 45.2% 54.8%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 335 349 259 76 154 195
Base content per 1 kb (bases) 490 510 379 111 225 285
Base content (%) 49.0% 51.0%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 72 96 62 10 36 60
Base content per 1 kb (bases) 429 571 369 60 214 357
Base content (%) 42.9% 57.1%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 762 789 498 264 361 428
Base content per 1 kb (bases) 491 509 321 170 233 276
Base content (%) 49.1% 50.9%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 338 346 226 112 148 198
Base content per 1 kb (bases) 494 506 330 164 216 289
Base content (%) 49.4% 50.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 394 390 272 122 177 213
Base content per 1 kb (bases) 503 497 347 156 226 272
Base content (%) 50.3% 49.7%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 542 601 390 152 269 332
Base content per 1 kb (bases) 474 526 341 133 235 290
Base content (%) 47.4% 52.6%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 500 478 349 151 228 250
Base content per 1 kb (bases) 511 489 357 154 233 256
Base content (%) 51.1% 48.9%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 495 545 361 134 239 306
Base content per 1 kb (bases) 476 524 347 129 230 294
Base content (%) 47.6% 52.4%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 171 180 115 56 87 93
Base content per 1 kb (bases) 487 513 328 160 248 265
Base content (%) 48.7% 51.3%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 688 690 517 171 295 395
Base content per 1 kb (bases) 499 501 375 124 214 287
Base content (%) 49.9% 50.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 149 148 105 44 71 77
Base content per 1 kb (bases) 502 498 354 148 239 259
Base content (%) 50.2% 49.8%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 862 956 633 229 395 561
Base content per 1 kb (bases) 474 526 348 126 217 309
Base content (%) 47.4% 52.6%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 258 261 201 57 67 194
Base content per 1 kb (bases) 497 503 387 110 129 374
Base content (%) 49.7% 50.3%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 62 (27.31%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 16 (7.05%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 17 6 5 13 32 7 5 7 1 3 2 1 2 1 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 12 4 0 0 7 1 1 3 5 7 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 13 0 0 8 5 0 0 5 0 3 0 0 0 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 1 1 4 0 0 1 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 89 64 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 67 33 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 103 98 13
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFFIMIITWLTFTLIIQPKLLSFTSTNPPHSKKPKTSKTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 10 (18.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 5 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 0 0 2 3 0 0 2 0 0 0 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 0 0 0 0 0 0 0 2 3 4 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 3 0 0 2 1 0 0 1 0 0 0 0 1 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 2 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
0 17 26 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 22 12 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 23 22 7
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 48 (9.3%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 38 (7.36%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.75%)
Leucine (Leu, L)
n = 62 (12.02%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 22 (4.26%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 44 (8.53%)
Tyrosine (Tyr, Y)
n = 16 (3.1%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 28 14 4 10 39 4 4 10 0 6 7 23 4 4 40
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 1 7 27 13 1 1 18 24 4 4 11 14 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 17 0 1 12 11 0 0 4 2 14 1 1 0 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 9 1 3 12 9 0 0 2 6 0 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
160 124 126 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 140 93 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 234 209 48
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 22 (9.69%)
Threonine (Thr, T)
n = 13 (5.73%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 18 (7.93%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 14 (6.17%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 12 4 5 7 17 2 0 6 1 2 7 9 0 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 2 2 12 2 1 1 2 4 1 2 4 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 6 0 1 9 8 0 0 4 2 6 0 0 1 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 8 6 0 12 5 0 1 1 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 64 52 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 60 61 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 102 85 24
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 12 4 3 9 17 2 2 7 0 0 7 9 0 2 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 14 7 0 0 7 11 1 2 5 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 9 1 2 4 5 1 1 3 1 10 0 0 1 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 1 0 4 3 0 1 0 3 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 72 57 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 73 54 93
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 127 102 22
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 29 (7.63%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 26 (6.84%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 21 (5.53%)
Leucine (Leu, L)
n = 67 (17.63%)
Isoleucine (Ile, I)
n = 31 (8.16%)
Methionine (Met, M)
n = 8 (2.11%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 7 (1.84%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 25 7 4 16 42 1 4 5 2 0 8 12 1 3 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 6 12 10 1 0 6 14 4 1 13 10 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 12 0 2 8 9 2 0 1 1 11 1 0 2 19 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 2 1 7 10 0 2 0 6 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
89 114 97 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 100 78 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 176 157 33
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.62%)
Alanine (Ala, A)
n = 33 (10.15%)
Serine (Ser, S)
n = 23 (7.08%)
Threonine (Thr, T)
n = 18 (5.54%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 15 (4.62%)
Leucine (Leu, L)
n = 63 (19.38%)
Isoleucine (Ile, I)
n = 22 (6.77%)
Methionine (Met, M)
n = 14 (4.31%)
Proline (Pro, P)
n = 28 (8.62%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 15 (4.62%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 5 (1.54%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 12 (3.69%)
Glutamine (Gln, Q)
n = 5 (1.54%)
Histidine (His, H)
n = 3 (0.92%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 18 9 4 15 33 8 3 4 1 0 7 6 2 3 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 4 17 11 1 0 7 4 4 4 11 11 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 6 0 1 12 5 0 2 3 5 10 2 0 2 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 6 5 0 5 6 1 2 2 3 1 0 1 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 104 79 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 97 58 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 148 113 32
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 37 (10.72%)
Serine (Ser, S)
n = 28 (8.12%)
Threonine (Thr, T)
n = 39 (11.3%)
Cysteine (Cys, C)
n = 4 (1.16%)
Valine (Val, V)
n = 12 (3.48%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 28 (8.12%)
Methionine (Met, M)
n = 17 (4.93%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 13 (3.77%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 11 (3.19%)
Histidine (His, H)
n = 8 (2.32%)
Lysine (Lys, K)
n = 12 (3.48%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 17 8 6 12 36 6 3 7 4 0 4 6 2 2 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 3 7 16 14 0 1 3 8 1 3 7 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 14 0 1 16 5 1 0 5 4 4 3 0 0 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 3 2 1 1 11 1 1 1 2 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 103 113 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 119 58 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 139 134 44
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 37 (10.72%)
Serine (Ser, S)
n = 28 (8.12%)
Threonine (Thr, T)
n = 39 (11.3%)
Cysteine (Cys, C)
n = 4 (1.16%)
Valine (Val, V)
n = 12 (3.48%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 28 (8.12%)
Methionine (Met, M)
n = 17 (4.93%)
Proline (Pro, P)
n = 20 (5.8%)
Phenylalanine (Phe, F)
n = 13 (3.77%)
Tyrosine (Tyr, Y)
n = 8 (2.32%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 11 (3.19%)
Histidine (His, H)
n = 8 (2.32%)
Lysine (Lys, K)
n = 12 (3.48%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 17 8 6 12 36 6 3 7 4 0 4 6 2 2 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 3 7 16 14 0 1 3 8 1 3 7 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 14 0 1 16 5 1 0 5 4 4 3 0 0 12 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 3 2 1 1 11 1 1 1 2 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 103 113 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 119 58 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
29 139 134 44
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.15%)
Alanine (Ala, A)
n = 42 (9.17%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 40 (8.73%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 12 (2.62%)
Leucine (Leu, L)
n = 96 (20.96%)
Isoleucine (Ile, I)
n = 41 (8.95%)
Methionine (Met, M)
n = 25 (5.46%)
Proline (Pro, P)
n = 31 (6.77%)
Phenylalanine (Phe, F)
n = 12 (2.62%)
Tyrosine (Tyr, Y)
n = 12 (2.62%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 14 (3.06%)
Glutamine (Gln, Q)
n = 13 (2.84%)
Histidine (His, H)
n = 17 (3.71%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 34 21 4 24 51 10 4 12 1 2 3 7 0 1 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 4 29 8 1 0 9 8 2 3 15 12 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 15 2 1 17 10 0 1 8 0 12 0 3 0 14 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 3 7 1 1 10 0 0 5 5 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 161 139 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 141 78 186
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 215 178 34
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 5 4 0 0 11 3 4 2 1 0 1 1 0 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 0 7 2 1 0 2 1 1 1 0 1 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 0 1 6 1 0 0 4 1 2 1 1 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 1 1 0 1 0 0 0 0 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 28 25 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 30 18 37
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 47 34 7
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 34 (5.62%)
Alanine (Ala, A)
n = 49 (8.1%)
Serine (Ser, S)
n = 47 (7.77%)
Threonine (Thr, T)
n = 66 (10.91%)
Cysteine (Cys, C)
n = 8 (1.32%)
Valine (Val, V)
n = 18 (2.98%)
Leucine (Leu, L)
n = 102 (16.86%)
Isoleucine (Ile, I)
n = 57 (9.42%)
Methionine (Met, M)
n = 26 (4.3%)
Proline (Pro, P)
n = 31 (5.12%)
Phenylalanine (Phe, F)
n = 38 (6.28%)
Tyrosine (Tyr, Y)
n = 13 (2.15%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 27 (4.46%)
Glutamine (Gln, Q)
n = 18 (2.98%)
Histidine (His, H)
n = 11 (1.82%)
Lysine (Lys, K)
n = 21 (3.47%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 47 19 5 18 64 12 3 18 0 1 5 11 1 3 35
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 6 4 30 13 2 1 13 16 4 4 9 18 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
37 25 1 2 19 15 1 1 9 2 11 3 0 4 23 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 3 1 7 21 0 0 3 3 2 1 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
120 167 208 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 183 109 241
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 283 244 43
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (18.6%)
Alanine (Ala, A)
n = 11 (6.4%)
Serine (Ser, S)
n = 12 (6.98%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 30 (17.44%)
Leucine (Leu, L)
n = 29 (16.86%)
Isoleucine (Ile, I)
n = 5 (2.91%)
Methionine (Met, M)
n = 7 (4.07%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 10 (5.81%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 5 (2.91%)
Aspartic acid (Asp, D)
n = 4 (2.33%)
Glutamic acid (Glu, E)
n = 5 (2.91%)
Asparagine (Asn, N)
n = 3 (1.74%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 2 3 0 2 5 5 0 0 8 4 6 12 9 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 4 1 2 4 5 0 6 21 2 1 0 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 6 1 2 2 1 0 6 1 3 14 2 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 4 4 0 0 0 0 0 1 3 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 18 18 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 28 20 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
75 11 29 58
Total protein-coding genes (size: 11395 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 229 (6.03%)
Alanine (Ala, A)
n = 325 (8.56%)
Serine (Ser, S)
n = 277 (7.3%)
Threonine (Thr, T)
n = 314 (8.27%)
Cysteine (Cys, C)
n = 32 (0.84%)
Valine (Val, V)
n = 195 (5.14%)
Leucine (Leu, L)
n = 661 (17.41%)
Isoleucine (Ile, I)
n = 284 (7.48%)
Methionine (Met, M)
n = 156 (4.11%)
Proline (Pro, P)
n = 228 (6.01%)
Phenylalanine (Phe, F)
n = 222 (5.85%)
Tyrosine (Tyr, Y)
n = 110 (2.9%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 93 (2.45%)
Asparagine (Asn, N)
n = 130 (3.42%)
Glutamine (Gln, Q)
n = 95 (2.5%)
Histidine (His, H)
n = 104 (2.74%)
Lysine (Lys, K)
n = 88 (2.32%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
58 226 101 45 133 359 65 38 84 11 22 56 93 24 36 186
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
55 7 25 41 182 90 12 9 75 99 46 31 88 102 7 30
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
155 125 4 20 116 80 7 6 48 25 85 15 21 13 117 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
93 59 34 12 54 83 5 7 15 41 8 1 2 5 2 92
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
908 1100 1029 760
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
496 1090 693 1518
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
318 1654 1452 373

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.