Viewing data for Castor canadensis


Scientific name Castor canadensis
Common name American beaver
Maximum lifespan 23.40 years (Castor canadensis@AnAge)

Total mtDNA (size: 16701 bases) GC AT G C A T
Base content (bases) 6956 9745 4708 2248 4118 5627
Base content per 1 kb (bases) 417 583 282 135 247 337
Base content (%) 41.7% 58.3%
Total protein-coding genes (size: 10812 bases) GC AT G C A T
Base content (bases) 4628 6184 3276 1352 2710 3474
Base content per 1 kb (bases) 428 572 303 125 251 321
Base content (%) 42.8% 57.2%
D-loop (size: 732 bases) GC AT G C A T
Base content (bases) 287 445 176 111 199 246
Base content per 1 kb (bases) 392 608 240 152 272 336
Base content (%) 39.2% 60.8%
Total tRNA-coding genes (size: 1498 bases) GC AT G C A T
Base content (bases) 574 924 337 237 388 536
Base content per 1 kb (bases) 383 617 225 158 259 358
Base content (%) 38.3% 61.7%
Total rRNA-coding genes (size: 2449 bases) GC AT G C A T
Base content (bases) 984 1465 562 422 573 892
Base content per 1 kb (bases) 402 598 229 172 234 364
Base content (%) 40.2% 59.8%
12S rRNA gene (size: 872 bases) GC AT G C A T
Base content (bases) 357 515 201 156 204 311
Base content per 1 kb (bases) 409 591 231 179 234 357
Base content (%) 40.9% 59.1%
16S rRNA gene (size: 1577 bases) GC AT G C A T
Base content (bases) 627 950 361 266 369 581
Base content per 1 kb (bases) 398 602 229 169 234 368
Base content (%) 39.8% 60.2%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 276 405 206 70 185 220
Base content per 1 kb (bases) 405 595 302 103 272 323
Base content (%) 40.5% 59.5%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 68 136 56 12 54 82
Base content per 1 kb (bases) 333 667 275 59 265 402
Base content (%) 33.3% 66.7%
COX1 (size: 1543 bases) GC AT G C A T
Base content (bases) 696 847 426 270 415 432
Base content per 1 kb (bases) 451 549 276 175 269 280
Base content (%) 45.1% 54.9%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 290 394 193 97 162 232
Base content per 1 kb (bases) 424 576 282 142 237 339
Base content (%) 42.4% 57.6%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 358 426 241 117 203 223
Base content per 1 kb (bases) 457 543 307 149 259 284
Base content (%) 45.7% 54.3%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 517 623 363 154 274 349
Base content per 1 kb (bases) 454 546 318 135 240 306
Base content (%) 45.4% 54.6%
ND1 (size: 955 bases) GC AT G C A T
Base content (bases) 417 538 307 110 236 302
Base content per 1 kb (bases) 437 563 321 115 247 316
Base content (%) 43.7% 56.3%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 427 615 326 101 234 381
Base content per 1 kb (bases) 410 590 313 97 225 366
Base content (%) 41.0% 59.0%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 149 197 107 42 94 103
Base content per 1 kb (bases) 431 569 309 121 272 298
Base content (%) 43.1% 56.9%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 571 807 418 153 343 464
Base content per 1 kb (bases) 414 586 303 111 249 337
Base content (%) 41.4% 58.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 124 173 88 36 85 88
Base content per 1 kb (bases) 418 582 296 121 286 296
Base content (%) 41.8% 58.2%
ND5 (size: 1809 bases) GC AT G C A T
Base content (bases) 749 1060 555 194 444 616
Base content per 1 kb (bases) 414 586 307 107 245 341
Base content (%) 41.4% 58.6%
ND6: No data available for this section.

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (4.42%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 40 (17.7%)
Isoleucine (Ile, I)
n = 28 (12.39%)
Methionine (Met, M)
n = 14 (6.19%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 7 (3.1%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 13 12 3 10 19 3 4 6 1 4 1 4 0 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 8 6 0 0 2 8 0 3 1 10 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 0 3 3 4 0 1 3 1 2 0 1 3 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 1 4 1 1 1 2 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 67 86 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 64 37 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 75 97 46
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFTTITSMILTLFIIFQLKVKTFTFTPNPTPKNVESMKQKNPWEKKWTKIYLPLLLPLL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 3 (4.48%)
Threonine (Thr, T)
n = 11 (16.42%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (2.99%)
Leucine (Leu, L)
n = 10 (14.93%)
Isoleucine (Ile, I)
n = 5 (7.46%)
Methionine (Met, M)
n = 3 (4.48%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 5 (7.46%)
Tyrosine (Tyr, Y)
n = 1 (1.49%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 3 (4.48%)
Glutamine (Gln, Q)
n = 3 (4.48%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 8 (11.94%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 2 1 2 4 0 2 3 0 1 0 1 0 0 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 3 3 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 6 2 2 1 0 0 0 0 1 0 0 1 2 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 1 0 8 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 17 30 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 21 19 25
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 18 33 13
COX1 (size: 1543 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.36%)
Alanine (Ala, A)
n = 39 (7.6%)
Serine (Ser, S)
n = 31 (6.04%)
Threonine (Thr, T)
n = 39 (7.6%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.6%)
Leucine (Leu, L)
n = 60 (11.7%)
Isoleucine (Ile, I)
n = 38 (7.41%)
Methionine (Met, M)
n = 29 (5.65%)
Proline (Pro, P)
n = 28 (5.46%)
Phenylalanine (Phe, F)
n = 42 (8.19%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 16 (3.12%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 19 (3.7%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 26 20 8 9 26 7 7 3 4 3 10 20 6 20 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 1 6 16 16 1 6 12 26 4 3 8 15 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 22 2 7 11 10 0 0 3 6 13 1 3 2 14 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 2 3 12 8 1 1 1 6 0 0 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 112 134 117
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 134 95 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 180 203 89
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 10 (4.41%)
Leucine (Leu, L)
n = 35 (15.42%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 4 (1.76%)
Tyrosine (Tyr, Y)
n = 12 (5.29%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 6 (2.64%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 13 12 6 6 20 1 2 3 3 1 1 6 2 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 3 3 3 0 0 4 4 0 0 2 11 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 6 4 5 3 7 0 1 4 6 6 1 0 0 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 14 1 1 9 5 0 0 1 3 2 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 65 70 41
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 56 61 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 72 101 36
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 23 (8.85%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 11 7 3 6 20 3 1 6 1 4 5 8 0 8 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 2 7 6 0 3 10 8 0 1 2 7 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 9 0 1 7 11 0 0 4 2 8 0 1 1 5 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 0 2 3 4 0 0 0 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 70 58 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 66 54 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 105 111 37
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 29 (7.65%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 14 (3.69%)
Leucine (Leu, L)
n = 54 (14.25%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 12 (3.17%)
Proline (Pro, P)
n = 25 (6.6%)
Phenylalanine (Phe, F)
n = 29 (7.65%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 27 10 2 11 35 4 2 5 1 1 6 7 0 8 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 4 0 10 16 1 0 8 12 4 3 7 14 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 19 0 3 7 12 0 0 4 3 10 1 0 3 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 4 2 1 11 8 2 1 0 7 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 103 112 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 103 74 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 157 163 42
ND1 (size: 955 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 24 (7.57%)
Threonine (Thr, T)
n = 23 (7.26%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 13 (4.1%)
Leucine (Leu, L)
n = 49 (15.46%)
Isoleucine (Ile, I)
n = 31 (9.78%)
Methionine (Met, M)
n = 22 (6.94%)
Proline (Pro, P)
n = 23 (7.26%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 8 (2.52%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 27 19 2 11 29 2 5 5 2 3 5 5 0 4 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 4 12 12 0 0 5 6 1 0 6 16 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 9 0 4 7 11 0 0 2 6 5 1 0 3 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 0 3 7 0 0 0 8 0 0 0 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 85 98 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 96 55 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 126 149 32
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 20 (5.78%)
Serine (Ser, S)
n = 23 (6.65%)
Threonine (Thr, T)
n = 45 (13.01%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 60 (17.34%)
Isoleucine (Ile, I)
n = 33 (9.54%)
Methionine (Met, M)
n = 34 (9.83%)
Proline (Pro, P)
n = 23 (6.65%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 24 31 2 8 40 3 6 8 1 0 2 7 0 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 0 13 6 1 1 4 9 1 1 7 15 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 19 1 1 5 8 3 1 5 3 6 0 1 3 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 0 0 3 10 1 0 1 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 97 145 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 105 60 147
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 124 176 32
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 20 (5.78%)
Serine (Ser, S)
n = 23 (6.65%)
Threonine (Thr, T)
n = 45 (13.01%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 60 (17.34%)
Isoleucine (Ile, I)
n = 33 (9.54%)
Methionine (Met, M)
n = 34 (9.83%)
Proline (Pro, P)
n = 23 (6.65%)
Phenylalanine (Phe, F)
n = 11 (3.18%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 8 (2.31%)
Lysine (Lys, K)
n = 11 (3.18%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 24 31 2 8 40 3 6 8 1 0 2 7 0 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 0 13 6 1 1 4 9 1 1 7 15 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 19 1 1 5 8 3 1 5 3 6 0 1 3 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 0 0 3 10 1 0 1 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 97 145 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 105 60 147
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 124 176 32
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 27 (5.9%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 39 (8.52%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 15 (3.28%)
Leucine (Leu, L)
n = 95 (20.74%)
Isoleucine (Ile, I)
n = 39 (8.52%)
Methionine (Met, M)
n = 35 (7.64%)
Proline (Pro, P)
n = 20 (4.37%)
Phenylalanine (Phe, F)
n = 18 (3.93%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 27 (5.9%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 12 (2.62%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 28 31 5 14 50 10 15 10 1 3 5 6 1 5 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 2 12 13 0 2 6 9 1 2 8 9 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 19 1 2 10 17 1 2 7 4 10 2 1 4 23 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 2 0 3 9 2 0 0 10 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 132 160 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 116 88 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 170 216 46
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 8 (8.16%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 10 (10.2%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 1 (1.02%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 6 5 1 1 14 4 1 2 0 1 2 2 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 0 4 5 0 1 0 3 0 0 2 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 1 0 3 5 0 0 0 2 2 0 1 0 6 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 26 28 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 25 17 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 37 43 12
ND5 (size: 1809 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.65%)
Alanine (Ala, A)
n = 40 (6.64%)
Serine (Ser, S)
n = 52 (8.64%)
Threonine (Thr, T)
n = 57 (9.47%)
Cysteine (Cys, C)
n = 4 (0.66%)
Valine (Val, V)
n = 18 (2.99%)
Leucine (Leu, L)
n = 96 (15.95%)
Isoleucine (Ile, I)
n = 59 (9.8%)
Methionine (Met, M)
n = 36 (5.98%)
Proline (Pro, P)
n = 23 (3.82%)
Phenylalanine (Phe, F)
n = 40 (6.64%)
Tyrosine (Tyr, Y)
n = 16 (2.66%)
Tryptophan (Trp, W)
n = 12 (1.99%)
Aspartic acid (Asp, D)
n = 12 (1.99%)
Glutamic acid (Glu, E)
n = 11 (1.83%)
Asparagine (Asn, N)
n = 34 (5.65%)
Glutamine (Gln, Q)
n = 15 (2.49%)
Histidine (His, H)
n = 15 (2.49%)
Lysine (Lys, K)
n = 26 (4.32%)
Arginine (Arg, R)
n = 8 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 40 33 5 23 51 5 9 14 1 1 4 12 1 12 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 4 7 15 17 1 0 7 18 3 3 13 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 29 1 3 16 21 2 1 9 2 14 0 3 7 27 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 10 1 1 11 24 2 1 1 6 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
109 145 222 127
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 162 130 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 248 264 68
ND6: No data available for this section.
Total protein-coding genes (size: 10863 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 192 (5.31%)
Alanine (Ala, A)
n = 240 (6.63%)
Serine (Ser, S)
n = 269 (7.44%)
Threonine (Thr, T)
n = 317 (8.76%)
Cysteine (Cys, C)
n = 23 (0.64%)
Valine (Val, V)
n = 155 (4.28%)
Leucine (Leu, L)
n = 579 (16.0%)
Isoleucine (Ile, I)
n = 329 (9.09%)
Methionine (Met, M)
n = 220 (6.08%)
Proline (Pro, P)
n = 197 (5.44%)
Phenylalanine (Phe, F)
n = 219 (6.05%)
Tyrosine (Tyr, Y)
n = 116 (3.21%)
Tryptophan (Trp, W)
n = 98 (2.71%)
Aspartic acid (Asp, D)
n = 68 (1.88%)
Glutamic acid (Glu, E)
n = 87 (2.4%)
Asparagine (Asn, N)
n = 161 (4.45%)
Glutamine (Gln, Q)
n = 83 (2.29%)
Histidine (His, H)
n = 97 (2.68%)
Lysine (Lys, K)
n = 99 (2.74%)
Arginine (Arg, R)
n = 64 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
102 227 186 40 110 316 45 56 68 15 24 43 78 10 73 146
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
34 0 23 28 101 107 4 14 58 105 15 21 61 108 7 28
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
125 152 12 31 75 110 6 6 41 37 79 7 12 29 132 24
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
73 78 9 9 59 89 10 4 5 52 3 1 0 5 0 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
742 952 1174 751
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
425 976 716 1502
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
189 1358 1602 470

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.