Viewing data for Vulpes zerda


Scientific name Vulpes zerda
Common name Fennec
Maximum lifespan 16.30 years (Vulpes zerda@AnAge)

Total mtDNA (size: 16683 bases) GC AT G C A T
Base content (bases) 6866 9817 4406 2460 4580 5237
Base content per 1 kb (bases) 412 588 264 147 275 314
Base content (%) 41.2% 58.8%
Total protein-coding genes (size: 11339 bases) GC AT G C A T
Base content (bases) 4729 6610 3168 1561 3214 3396
Base content per 1 kb (bases) 417 583 279 138 283 299
Base content (%) 41.7% 58.3%
D-loop (size: 1220 bases) GC AT G C A T
Base content (bases) 539 681 351 188 315 366
Base content per 1 kb (bases) 442 558 288 154 258 300
Base content (%) 44.2% 55.8%
Total tRNA-coding genes (size: 1510 bases) GC AT G C A T
Base content (bases) 549 961 309 240 434 527
Base content per 1 kb (bases) 364 636 205 159 287 349
Base content (%) 36.4% 63.6%
Total rRNA-coding genes (size: 2539 bases) GC AT G C A T
Base content (bases) 1015 1524 560 455 602 922
Base content per 1 kb (bases) 400 600 221 179 237 363
Base content (%) 40.0% 60.0%
12S rRNA gene (size: 957 bases) GC AT G C A T
Base content (bases) 393 564 217 176 220 344
Base content per 1 kb (bases) 411 589 227 184 230 359
Base content (%) 41.1% 58.9%
16S rRNA gene (size: 1582 bases) GC AT G C A T
Base content (bases) 622 960 343 279 382 578
Base content per 1 kb (bases) 393 607 217 176 241 365
Base content (%) 39.3% 60.7%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 287 394 201 86 193 201
Base content per 1 kb (bases) 421 579 295 126 283 295
Base content (%) 42.1% 57.9%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 70 134 51 19 58 76
Base content per 1 kb (bases) 343 657 250 93 284 373
Base content (%) 34.3% 65.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 665 880 387 278 467 413
Base content per 1 kb (bases) 430 570 250 180 302 267
Base content (%) 43.0% 57.0%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 281 403 177 104 184 219
Base content per 1 kb (bases) 411 589 259 152 269 320
Base content (%) 41.1% 58.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 364 420 235 129 217 203
Base content per 1 kb (bases) 464 536 300 165 277 259
Base content (%) 46.4% 53.6%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 483 657 318 165 333 324
Base content per 1 kb (bases) 424 576 279 145 292 284
Base content (%) 42.4% 57.6%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 428 528 309 119 258 270
Base content per 1 kb (bases) 448 552 323 124 270 282
Base content (%) 44.8% 55.2%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 405 637 294 111 281 356
Base content per 1 kb (bases) 389 611 282 107 270 342
Base content (%) 38.9% 61.1%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 136 211 91 45 106 105
Base content per 1 kb (bases) 392 608 262 130 305 303
Base content (%) 39.2% 60.8%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 569 809 396 173 394 415
Base content per 1 kb (bases) 413 587 287 126 286 301
Base content (%) 41.3% 58.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 115 182 71 44 94 88
Base content per 1 kb (bases) 387 613 239 148 316 296
Base content (%) 38.7% 61.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 746 1075 510 236 531 544
Base content per 1 kb (bases) 410 590 280 130 292 299
Base content (%) 41.0% 59.0%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 202 326 144 58 119 207
Base content per 1 kb (bases) 383 617 273 110 225 392
Base content (%) 38.3% 61.7%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 18 (7.96%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 43 (19.03%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 7 (3.1%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 8 7 5 5 17 4 10 5 4 1 4 5 0 3 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 4 10 4 0 0 2 6 3 3 7 3 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 0 5 1 3 1 3 0 0 2 0 2 4 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 1 0 1 3 1 0 1 4 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 65 79 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 65 38 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 71 84 51
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWLVMILSMILTLFILFQLKVSKHYYPESPGPKSIKSISKHTPWENKWTKIYSPLSLPLQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.49%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 9 (13.43%)
Threonine (Thr, T)
n = 5 (7.46%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (2.99%)
Leucine (Leu, L)
n = 10 (14.93%)
Isoleucine (Ile, I)
n = 6 (8.96%)
Methionine (Met, M)
n = 3 (4.48%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 2 (2.99%)
Tyrosine (Tyr, Y)
n = 3 (4.48%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 1 (1.49%)
Glutamine (Gln, Q)
n = 3 (4.48%)
Histidine (His, H)
n = 2 (2.99%)
Lysine (Lys, K)
n = 7 (10.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 2 2 2 0 5 1 2 2 1 1 0 1 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 1 0 3 1 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 1 2 0 4 1 0 2 2 1 0 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 0 1 6 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 20 24 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 19 20 23
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 12 32 17
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 41 (7.98%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.81%)
Leucine (Leu, L)
n = 58 (11.28%)
Isoleucine (Ile, I)
n = 40 (7.78%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 19 24 6 6 19 7 17 5 2 6 9 15 5 17 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 0 13 11 13 4 10 10 18 9 8 12 6 2 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 5 7 8 11 1 1 2 7 12 1 3 8 9 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 3 5 10 9 0 2 0 3 3 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
148 99 141 127
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 96 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
54 153 176 132
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 16 (7.05%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 4 12 4 4 12 3 8 5 2 7 4 5 0 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 1 4 2 2 1 2 5 0 2 3 7 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 6 0 4 4 5 0 0 4 5 6 0 2 1 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 11 4 3 7 2 2 0 0 6 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 56 66 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 61 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 67 92 48
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 8 7 5 5 16 3 2 6 1 3 8 5 1 8 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 4 8 2 0 2 6 9 4 2 2 5 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 0 7 6 4 1 0 3 6 7 2 0 2 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 6 2 1 2 0 2 0 1 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 69 60 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 66 57 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 100 86 52
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 17 (4.49%)
Leucine (Leu, L)
n = 55 (14.51%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 13 (3.43%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 15 (3.96%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 23 8 10 9 21 2 11 4 2 5 3 7 2 11 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 4 5 6 13 2 2 5 14 4 3 9 8 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 0 6 5 12 0 1 2 9 5 1 2 5 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 0 2 11 8 1 1 1 5 1 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
87 91 109 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 97 76 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 130 139 86
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 29 (9.15%)
Serine (Ser, S)
n = 22 (6.94%)
Threonine (Thr, T)
n = 20 (6.31%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 14 (4.42%)
Leucine (Leu, L)
n = 57 (17.98%)
Isoleucine (Ile, I)
n = 31 (9.78%)
Methionine (Met, M)
n = 17 (5.36%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 21 (6.62%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 19 14 3 18 26 3 7 6 0 2 5 5 2 2 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 3 17 8 1 0 4 6 2 5 10 7 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 1 3 9 7 1 1 1 6 5 1 0 5 8 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 3 1 2 7 0 0 1 6 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 90 90 69
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 91 55 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 128 124 48
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 23 (6.65%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 33 (9.54%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 54 (15.61%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 39 (11.27%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 19 38 5 11 26 8 3 6 3 3 5 2 1 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 7 13 2 3 4 6 2 6 6 8 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 14 0 3 12 11 2 1 2 2 7 0 1 5 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 1 2 13 2 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 87 140 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 104 59 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 103 157 64
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 23 (6.65%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 33 (9.54%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 54 (15.61%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 39 (11.27%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 12 (3.47%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 13 (3.76%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 19 38 5 11 26 8 3 6 3 3 5 2 1 6 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 7 13 2 3 4 6 2 6 6 8 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 14 0 3 12 11 2 1 2 2 7 0 1 5 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 1 1 2 13 2 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
57 87 140 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 104 59 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 103 157 64
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 32 (6.99%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 36 (7.86%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 95 (20.74%)
Isoleucine (Ile, I)
n = 44 (9.61%)
Methionine (Met, M)
n = 32 (6.99%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 17 (3.71%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 5 (1.09%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 20 (4.37%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 10 (2.18%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 18 28 14 13 41 11 10 9 2 2 2 9 0 3 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 1 7 9 14 2 6 4 3 4 5 10 6 3 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 15 1 8 11 9 1 5 6 5 12 2 6 5 15 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 4 0 5 11 2 2 1 5 2 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 134 156 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 121 84 200
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 141 175 99
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 9 (9.18%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 8 1 2 10 5 3 2 0 1 1 4 3 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 1 2 3 0 0 2 2 0 0 0 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 3 2 4 0 0 1 2 2 0 1 2 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 24 28 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 20 18 52
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 27 42 17
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.79%)
Alanine (Ala, A)
n = 45 (7.43%)
Serine (Ser, S)
n = 52 (8.58%)
Threonine (Thr, T)
n = 51 (8.42%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 23 (3.8%)
Leucine (Leu, L)
n = 85 (14.03%)
Isoleucine (Ile, I)
n = 54 (8.91%)
Methionine (Met, M)
n = 43 (7.1%)
Proline (Pro, P)
n = 23 (3.8%)
Phenylalanine (Phe, F)
n = 44 (7.26%)
Tyrosine (Tyr, Y)
n = 21 (3.47%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 12 (1.98%)
Glutamic acid (Glu, E)
n = 10 (1.65%)
Asparagine (Asn, N)
n = 27 (4.46%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 18 (2.97%)
Lysine (Lys, K)
n = 24 (3.96%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 24 33 13 22 28 8 10 17 2 6 5 8 4 17 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 1 4 6 19 19 1 4 10 10 5 4 12 7 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 12 3 10 13 13 3 6 7 11 10 2 4 12 15 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 6 4 6 6 21 3 2 2 5 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
119 140 212 136
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 158 132 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
49 212 200 146
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.57%)
Alanine (Ala, A)
n = 11 (6.29%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 12 (6.86%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 21 (12.0%)
Leucine (Leu, L)
n = 21 (12.0%)
Isoleucine (Ile, I)
n = 15 (8.57%)
Methionine (Met, M)
n = 9 (5.14%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 12 (6.86%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 2 3 0 0 2 3 10 1 0 7 0 6 8 10 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 7 1 1 2 12 1 5 4 2 1 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 1 5 0 1 0 3 2 5 4 3 6 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 7 4 1 1 3 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 10 49 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 32 32 78
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 16 38 79
Total protein-coding genes (size: 11407 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 265 (6.98%)
Serine (Ser, S)
n = 289 (7.61%)
Threonine (Thr, T)
n = 302 (7.95%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 190 (5.0%)
Leucine (Leu, L)
n = 589 (15.5%)
Isoleucine (Ile, I)
n = 335 (8.82%)
Methionine (Met, M)
n = 251 (6.61%)
Proline (Pro, P)
n = 193 (5.08%)
Phenylalanine (Phe, F)
n = 227 (5.98%)
Tyrosine (Tyr, Y)
n = 136 (3.58%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 75 (1.97%)
Glutamic acid (Glu, E)
n = 94 (2.47%)
Asparagine (Asn, N)
n = 144 (3.79%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 103 (2.71%)
Lysine (Lys, K)
n = 102 (2.68%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
183 152 190 74 99 232 62 95 70 19 45 46 73 26 86 141
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
61 6 18 54 96 99 16 40 52 86 37 45 75 63 10 74
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
108 108 12 64 72 86 12 22 33 62 74 13 27 56 88 28
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
75 64 30 24 51 84 18 9 7 42 7 1 0 7 0 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
839 917 1190 854
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
464 994 750 1592
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
350 1187 1391 872

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.