Viewing data for Petromyzon marinus


Scientific name Petromyzon marinus
Common name Sea lamprey
Maximum lifespan 9.00 years (Petromyzon marinus@AnAge)

Total mtDNA (size: 16201 bases) GC AT G C A T
Base content (bases) 6045 10156 3863 2182 4929 5227
Base content per 1 kb (bases) 373 627 238 135 304 323
Base content (%) 37.3% 62.7%
Total protein-coding genes (size: 11380 bases) GC AT G C A T
Base content (bases) 4178 7202 2776 1402 3606 3596
Base content per 1 kb (bases) 367 633 244 123 317 316
Base content (%) 36.7% 63.3%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1531 bases) GC AT G C A T
Base content (bases) 604 927 349 255 430 497
Base content per 1 kb (bases) 395 605 228 167 281 325
Base content (%) 39.5% 60.5%
Total rRNA-coding genes (size: 2521 bases) GC AT G C A T
Base content (bases) 1017 1504 571 446 595 909
Base content per 1 kb (bases) 403 597 226 177 236 361
Base content (%) 40.3% 59.7%
12S rRNA gene (size: 900 bases) GC AT G C A T
Base content (bases) 402 498 234 168 197 301
Base content per 1 kb (bases) 447 553 260 187 219 334
Base content (%) 44.7% 55.3%
16S rRNA gene (size: 1621 bases) GC AT G C A T
Base content (bases) 615 1006 337 278 398 608
Base content per 1 kb (bases) 379 621 208 171 246 375
Base content (%) 37.9% 62.1%

ATP6 (size: 679 bases) GC AT G C A T
Base content (bases) 235 444 165 70 226 218
Base content per 1 kb (bases) 346 654 243 103 333 321
Base content (%) 34.6% 65.4%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 59 109 48 11 52 57
Base content per 1 kb (bases) 351 649 286 65 310 339
Base content (%) 35.1% 64.9%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 601 953 359 242 513 440
Base content per 1 kb (bases) 387 613 231 156 330 283
Base content (%) 38.7% 61.3%
COX2 (size: 690 bases) GC AT G C A T
Base content (bases) 263 427 168 95 205 222
Base content per 1 kb (bases) 381 619 243 138 297 322
Base content (%) 38.1% 61.9%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 327 459 210 117 239 220
Base content per 1 kb (bases) 416 584 267 149 304 280
Base content (%) 41.6% 58.4%
CYTB (size: 1191 bases) GC AT G C A T
Base content (bases) 421 770 262 159 417 353
Base content per 1 kb (bases) 353 647 220 134 350 296
Base content (%) 35.3% 64.7%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 354 612 225 129 323 289
Base content per 1 kb (bases) 366 634 233 134 334 299
Base content (%) 36.6% 63.4%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 363 681 247 116 336 345
Base content per 1 kb (bases) 348 652 237 111 322 330
Base content (%) 34.8% 65.2%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 138 213 92 46 117 96
Base content per 1 kb (bases) 393 607 262 131 333 274
Base content (%) 39.3% 60.7%
ND4 (size: 1377 bases) GC AT G C A T
Base content (bases) 497 880 354 143 452 428
Base content per 1 kb (bases) 361 639 257 104 328 311
Base content (%) 36.1% 63.9%
ND4L (size: 291 bases) GC AT G C A T
Base content (bases) 116 175 82 34 90 85
Base content per 1 kb (bases) 399 601 282 117 309 292
Base content (%) 39.9% 60.1%
ND5 (size: 1797 bases) GC AT G C A T
Base content (bases) 617 1180 428 189 564 616
Base content per 1 kb (bases) 343 657 238 105 314 343
Base content (%) 34.3% 65.7%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 200 319 143 57 81 238
Base content per 1 kb (bases) 385 615 276 110 156 459
Base content (%) 38.5% 61.5%

ATP6 (size: 679 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.56%)
Alanine (Ala, A)
n = 18 (8.0%)
Serine (Ser, S)
n = 12 (5.33%)
Threonine (Thr, T)
n = 22 (9.78%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 11 (4.89%)
Leucine (Leu, L)
n = 49 (21.78%)
Isoleucine (Ile, I)
n = 23 (10.22%)
Methionine (Met, M)
n = 15 (6.67%)
Proline (Pro, P)
n = 15 (6.67%)
Phenylalanine (Phe, F)
n = 9 (4.0%)
Tyrosine (Tyr, Y)
n = 5 (2.22%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 2 (0.89%)
Glutamic acid (Glu, E)
n = 5 (2.22%)
Asparagine (Asn, N)
n = 5 (2.22%)
Glutamine (Gln, Q)
n = 10 (4.44%)
Histidine (His, H)
n = 4 (1.78%)
Lysine (Lys, K)
n = 6 (2.67%)
Arginine (Arg, R)
n = 3 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 8 14 10 3 14 2 20 9 1 4 3 3 1 9 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 6 8 4 0 2 0 3 3 3 2 10 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 4 1 5 0 1 1 5 0 0 0 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 1 1 1 6 0 1 0 2 0 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 61 73 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
17 65 37 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 39 108 70
ATP8 (size: 168 bases)
Amino acid sequence: MPQLDPAPWFSMLTVSWLIIFLLIMPTILFYQPQNTISTKQVTKPKQSTWTWPWH*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 7 (12.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.64%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 7 (12.73%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 1 (1.82%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 1 (1.82%)
Glutamine (Gln, Q)
n = 5 (9.09%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 2 1 2 1 0 2 5 0 1 0 1 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 0 0 0 0 0 0 2 1 4 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 1 0 2 1 1 0 0 0 1 0 0 0 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 1 0 3 0 0 0 0 0 0 0 0 1 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 17 19 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 19 13 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 12 25 17
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.7%)
Alanine (Ala, A)
n = 47 (9.09%)
Serine (Ser, S)
n = 26 (5.03%)
Threonine (Thr, T)
n = 40 (7.74%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.16%)
Leucine (Leu, L)
n = 63 (12.19%)
Isoleucine (Ile, I)
n = 40 (7.74%)
Methionine (Met, M)
n = 26 (5.03%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 42 (8.12%)
Tyrosine (Tyr, Y)
n = 18 (3.48%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 17 (3.29%)
Glutamine (Gln, Q)
n = 7 (1.35%)
Histidine (His, H)
n = 20 (3.87%)
Lysine (Lys, K)
n = 11 (2.13%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 10 22 17 3 24 0 19 6 1 19 7 10 1 19 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 20 16 11 0 4 6 30 5 8 7 12 1 17
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 18 0 7 3 12 0 4 0 13 5 0 0 8 9 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 0 5 10 10 1 5 0 3 0 1 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
153 107 139 119
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 137 97 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 115 204 186
COX2 (size: 690 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 13 (5.68%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 19 (8.3%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 19 (8.3%)
Leucine (Leu, L)
n = 24 (10.48%)
Isoleucine (Ile, I)
n = 22 (9.61%)
Methionine (Met, M)
n = 10 (4.37%)
Proline (Pro, P)
n = 13 (5.68%)
Phenylalanine (Phe, F)
n = 10 (4.37%)
Tyrosine (Tyr, Y)
n = 7 (3.06%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 10 (4.37%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 7 (3.06%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 5 9 5 6 4 1 7 9 0 4 4 11 0 6 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 3 2 8 0 4 3 2 0 2 2 9 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 8 0 4 7 2 0 2 1 4 3 0 1 5 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 13 1 3 7 4 0 2 0 3 1 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 54 65 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 58 62 85
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 56 95 74
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.66%)
Alanine (Ala, A)
n = 20 (7.66%)
Serine (Ser, S)
n = 15 (5.75%)
Threonine (Thr, T)
n = 24 (9.2%)
Cysteine (Cys, C)
n = 3 (1.15%)
Valine (Val, V)
n = 15 (5.75%)
Leucine (Leu, L)
n = 36 (13.79%)
Isoleucine (Ile, I)
n = 13 (4.98%)
Methionine (Met, M)
n = 10 (3.83%)
Proline (Pro, P)
n = 12 (4.6%)
Phenylalanine (Phe, F)
n = 20 (7.66%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 4 (1.53%)
Glutamic acid (Glu, E)
n = 9 (3.45%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 7 (2.68%)
Histidine (His, H)
n = 16 (6.13%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 4 8 11 0 13 1 10 7 0 8 2 4 1 9 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 6 9 5 0 4 11 5 0 2 3 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 0 3 3 6 0 1 2 6 6 1 1 2 3 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 0 1 3 3 0 0 1 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 65 58 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 57 94
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 77 105 74
CYTB (size: 1191 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (6.82%)
Alanine (Ala, A)
n = 31 (7.83%)
Serine (Ser, S)
n = 26 (6.57%)
Threonine (Thr, T)
n = 22 (5.56%)
Cysteine (Cys, C)
n = 3 (0.76%)
Valine (Val, V)
n = 19 (4.8%)
Leucine (Leu, L)
n = 53 (13.38%)
Isoleucine (Ile, I)
n = 41 (10.35%)
Methionine (Met, M)
n = 19 (4.8%)
Proline (Pro, P)
n = 21 (5.3%)
Phenylalanine (Phe, F)
n = 30 (7.58%)
Tyrosine (Tyr, Y)
n = 16 (4.04%)
Tryptophan (Trp, W)
n = 12 (3.03%)
Aspartic acid (Asp, D)
n = 7 (1.77%)
Glutamic acid (Glu, E)
n = 7 (1.77%)
Asparagine (Asn, N)
n = 22 (5.56%)
Glutamine (Gln, Q)
n = 9 (2.27%)
Histidine (His, H)
n = 12 (3.03%)
Lysine (Lys, K)
n = 11 (2.78%)
Arginine (Arg, R)
n = 8 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 10 18 9 6 14 1 22 9 0 10 2 7 0 20 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 10 11 10 0 6 5 14 2 8 2 9 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 0 8 5 8 1 4 0 11 5 3 1 14 8 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 1 4 3 10 1 1 3 4 0 1 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
91 80 120 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 96 84 162
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 86 149 149
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.92%)
Alanine (Ala, A)
n = 28 (8.72%)
Serine (Ser, S)
n = 25 (7.79%)
Threonine (Thr, T)
n = 19 (5.92%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 19 (5.92%)
Leucine (Leu, L)
n = 60 (18.69%)
Isoleucine (Ile, I)
n = 27 (8.41%)
Methionine (Met, M)
n = 18 (5.61%)
Proline (Pro, P)
n = 17 (5.3%)
Phenylalanine (Phe, F)
n = 20 (6.23%)
Tyrosine (Tyr, Y)
n = 9 (2.8%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 10 (3.12%)
Asparagine (Asn, N)
n = 13 (4.05%)
Glutamine (Gln, Q)
n = 9 (2.8%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.18%)
Arginine (Arg, R)
n = 7 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 9 16 14 6 23 0 17 9 0 7 3 8 1 13 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 6 9 13 0 3 3 9 4 4 3 10 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 5 0 7 5 9 0 3 1 5 4 1 0 8 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 9 1 3 0 5 2 0 1 6 0 0 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 78 88 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 85 54 144
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 62 147 102
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 26 (7.49%)
Serine (Ser, S)
n = 26 (7.49%)
Threonine (Thr, T)
n = 36 (10.37%)
Cysteine (Cys, C)
n = 4 (1.15%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 63 (18.16%)
Isoleucine (Ile, I)
n = 39 (11.24%)
Methionine (Met, M)
n = 22 (6.34%)
Proline (Pro, P)
n = 17 (4.9%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 18 (5.19%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 9 20 23 2 16 4 18 9 3 1 2 5 0 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 2 6 9 11 0 8 4 2 3 3 1 13 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 20 0 4 1 14 0 4 3 3 4 1 0 9 9 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 1 2 1 9 1 2 0 2 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 85 132 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 98 62 146
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 64 151 117
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (4.9%)
Alanine (Ala, A)
n = 26 (7.49%)
Serine (Ser, S)
n = 26 (7.49%)
Threonine (Thr, T)
n = 36 (10.37%)
Cysteine (Cys, C)
n = 4 (1.15%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 63 (18.16%)
Isoleucine (Ile, I)
n = 39 (11.24%)
Methionine (Met, M)
n = 22 (6.34%)
Proline (Pro, P)
n = 17 (4.9%)
Phenylalanine (Phe, F)
n = 14 (4.03%)
Tyrosine (Tyr, Y)
n = 7 (2.02%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 3 (0.86%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 18 (5.19%)
Glutamine (Gln, Q)
n = 12 (3.46%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 9 20 23 2 16 4 18 9 3 1 2 5 0 9 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 2 6 9 11 0 8 4 2 3 3 1 13 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 20 0 4 1 14 0 4 3 3 4 1 0 9 9 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 1 2 1 9 1 2 0 2 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 85 132 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 98 62 146
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 64 151 117
ND4 (size: 1377 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (3.49%)
Alanine (Ala, A)
n = 34 (7.42%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 39 (8.52%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 85 (18.56%)
Isoleucine (Ile, I)
n = 49 (10.7%)
Methionine (Met, M)
n = 35 (7.64%)
Proline (Pro, P)
n = 25 (5.46%)
Phenylalanine (Phe, F)
n = 24 (5.24%)
Tyrosine (Tyr, Y)
n = 8 (1.75%)
Tryptophan (Trp, W)
n = 14 (3.06%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 19 (4.15%)
Glutamine (Gln, Q)
n = 8 (1.75%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
29 20 32 18 9 30 2 25 8 0 1 4 5 0 7 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 5 1 13 11 10 0 5 5 3 3 5 6 14 0 18
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 0 11 4 12 1 3 6 5 3 0 1 8 11 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 8 2 3 1 11 2 4 1 4 0 1 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 114 165 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 126 75 203
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 114 188 143
ND4L (size: 291 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.13%)
Alanine (Ala, A)
n = 12 (12.5%)
Serine (Ser, S)
n = 8 (8.33%)
Threonine (Thr, T)
n = 10 (10.42%)
Cysteine (Cys, C)
n = 2 (2.08%)
Valine (Val, V)
n = 1 (1.04%)
Leucine (Leu, L)
n = 25 (26.04%)
Isoleucine (Ile, I)
n = 5 (5.21%)
Methionine (Met, M)
n = 5 (5.21%)
Proline (Pro, P)
n = 3 (3.13%)
Phenylalanine (Phe, F)
n = 4 (4.17%)
Tyrosine (Tyr, Y)
n = 1 (1.04%)
Tryptophan (Trp, W)
n = 1 (1.04%)
Aspartic acid (Asp, D)
n = 1 (1.04%)
Glutamic acid (Glu, E)
n = 2 (2.08%)
Asparagine (Asn, N)
n = 4 (4.17%)
Glutamine (Gln, Q)
n = 2 (2.08%)
Histidine (His, H)
n = 2 (2.08%)
Lysine (Lys, K)
n = 3 (3.13%)
Arginine (Arg, R)
n = 2 (2.08%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 2 3 3 9 2 8 2 0 1 0 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 2 5 5 0 3 0 0 0 1 0 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 3 1 3 2 2 0 1 0 1 0 0 0 1 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 3 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 26 28 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 32 16 40
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 24 41 26
ND5 (size: 1797 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (4.01%)
Alanine (Ala, A)
n = 44 (7.36%)
Serine (Ser, S)
n = 46 (7.69%)
Threonine (Thr, T)
n = 59 (9.87%)
Cysteine (Cys, C)
n = 8 (1.34%)
Valine (Val, V)
n = 16 (2.68%)
Leucine (Leu, L)
n = 91 (15.22%)
Isoleucine (Ile, I)
n = 57 (9.53%)
Methionine (Met, M)
n = 42 (7.02%)
Proline (Pro, P)
n = 29 (4.85%)
Phenylalanine (Phe, F)
n = 32 (5.35%)
Tyrosine (Tyr, Y)
n = 13 (2.17%)
Tryptophan (Trp, W)
n = 14 (2.34%)
Aspartic acid (Asp, D)
n = 10 (1.67%)
Glutamic acid (Glu, E)
n = 13 (2.17%)
Asparagine (Asn, N)
n = 29 (4.85%)
Glutamine (Gln, Q)
n = 18 (3.01%)
Histidine (His, H)
n = 17 (2.84%)
Lysine (Lys, K)
n = 26 (4.35%)
Arginine (Arg, R)
n = 10 (1.67%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
40 17 40 16 9 36 1 29 17 1 7 2 7 0 23 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 7 1 9 19 16 0 9 4 9 2 11 4 14 0 17
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 27 0 10 9 13 0 7 7 7 6 2 0 18 11 7
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 12 1 6 4 24 2 4 1 5 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
107 136 228 128
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 164 126 238
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 128 262 198
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (11.05%)
Alanine (Ala, A)
n = 15 (8.72%)
Serine (Ser, S)
n = 10 (5.81%)
Threonine (Thr, T)
n = 4 (2.33%)
Cysteine (Cys, C)
n = 7 (4.07%)
Valine (Val, V)
n = 31 (18.02%)
Leucine (Leu, L)
n = 28 (16.28%)
Isoleucine (Ile, I)
n = 6 (3.49%)
Methionine (Met, M)
n = 5 (2.91%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 17 (9.88%)
Tyrosine (Tyr, Y)
n = 8 (4.65%)
Tryptophan (Trp, W)
n = 3 (1.74%)
Aspartic acid (Asp, D)
n = 4 (2.33%)
Glutamic acid (Glu, E)
n = 4 (2.33%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 0 2 0 2 1 16 0 0 14 2 11 4 15 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 7 0 13 0 2 0 3 2 3 11 4 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 6 0 1 1 2 0 6 2 2 7 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 1 3 1 0 0 1 0 2 1 1 0 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 14 20 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 31 19 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 12 42 85
Total protein-coding genes (size: 11413 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 212 (5.57%)
Alanine (Ala, A)
n = 297 (7.81%)
Serine (Ser, S)
n = 261 (6.86%)
Threonine (Thr, T)
n = 306 (8.05%)
Cysteine (Cys, C)
n = 39 (1.03%)
Valine (Val, V)
n = 191 (5.02%)
Leucine (Leu, L)
n = 610 (16.04%)
Isoleucine (Ile, I)
n = 334 (8.78%)
Methionine (Met, M)
n = 216 (5.68%)
Proline (Pro, P)
n = 199 (5.23%)
Phenylalanine (Phe, F)
n = 235 (6.18%)
Tyrosine (Tyr, Y)
n = 107 (2.81%)
Tryptophan (Trp, W)
n = 109 (2.87%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 93 (2.45%)
Asparagine (Asn, N)
n = 145 (3.81%)
Glutamine (Gln, Q)
n = 98 (2.58%)
Histidine (His, H)
n = 105 (2.76%)
Lysine (Lys, K)
n = 99 (2.6%)
Arginine (Arg, R)
n = 68 (1.79%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
232 102 187 137 53 194 15 199 92 6 79 31 73 8 137 98
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
29 27 12 96 102 99 0 51 43 85 33 53 32 110 4 106
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
73 125 2 73 44 87 3 33 21 68 39 10 12 78 67 47
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
58 82 11 32 36 90 9 21 8 37 2 5 0 5 2 99
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
861 869 1159 915
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
487 1009 722 1586
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
146 819 1569 1270

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.