Viewing data for Anser anser


Scientific name Anser anser
Common name Greylag goose
Maximum lifespan 31.00 years (Anser anser@AnAge)

Total mtDNA (size: 16738 bases) GC AT G C A T
Base content (bases) 7906 8832 5379 2527 3780 5052
Base content per 1 kb (bases) 472 528 321 151 226 302
Base content (%) 47.2% 52.8%
Total protein-coding genes (size: 11385 bases) GC AT G C A T
Base content (bases) 5488 5897 3915 1573 2561 3336
Base content per 1 kb (bases) 482 518 344 138 225 293
Base content (%) 48.2% 51.8%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1537 bases) GC AT G C A T
Base content (bases) 649 888 386 263 379 509
Base content per 1 kb (bases) 422 578 251 171 247 331
Base content (%) 42.2% 57.8%
Total rRNA-coding genes (size: 2598 bases) GC AT G C A T
Base content (bases) 1210 1388 687 523 529 859
Base content per 1 kb (bases) 466 534 264 201 204 331
Base content (%) 46.6% 53.4%
12S rRNA gene (size: 988 bases) GC AT G C A T
Base content (bases) 475 513 274 201 197 316
Base content per 1 kb (bases) 481 519 277 203 199 320
Base content (%) 48.1% 51.9%
16S rRNA gene (size: 1610 bases) GC AT G C A T
Base content (bases) 735 875 413 322 332 543
Base content per 1 kb (bases) 457 543 257 200 206 337
Base content (%) 45.7% 54.3%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 313 371 250 63 166 205
Base content per 1 kb (bases) 458 542 365 92 243 300
Base content (%) 45.8% 54.2%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 76 92 65 11 34 58
Base content per 1 kb (bases) 452 548 387 65 202 345
Base content (%) 45.2% 54.8%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 757 794 499 258 376 418
Base content per 1 kb (bases) 488 512 322 166 242 270
Base content (%) 48.8% 51.2%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 340 347 230 110 151 196
Base content per 1 kb (bases) 495 505 335 160 220 285
Base content (%) 49.5% 50.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 391 393 267 124 175 218
Base content per 1 kb (bases) 499 501 341 158 223 278
Base content (%) 49.9% 50.1%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 562 581 400 162 266 315
Base content per 1 kb (bases) 492 508 350 142 233 276
Base content (%) 49.2% 50.8%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 462 516 315 147 249 267
Base content per 1 kb (bases) 472 528 322 150 255 273
Base content (%) 47.2% 52.8%
ND2 (size: 1041 bases) GC AT G C A T
Base content (bases) 499 542 368 131 230 312
Base content per 1 kb (bases) 479 521 354 126 221 300
Base content (%) 47.9% 52.1%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 178 174 121 57 86 88
Base content per 1 kb (bases) 506 494 344 162 244 250
Base content (%) 50.6% 49.4%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 646 732 481 165 317 415
Base content per 1 kb (bases) 469 531 349 120 230 301
Base content (%) 46.9% 53.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 146 151 99 47 74 77
Base content per 1 kb (bases) 492 508 333 158 249 259
Base content (%) 49.2% 50.8%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 860 958 617 243 389 569
Base content per 1 kb (bases) 473 527 339 134 214 313
Base content (%) 47.3% 52.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 263 259 206 57 52 207
Base content per 1 kb (bases) 504 496 395 109 100 397
Base content (%) 50.4% 49.6%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.08%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.08%)
Leucine (Leu, L)
n = 57 (25.11%)
Isoleucine (Ile, I)
n = 20 (8.81%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 10 (4.41%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 13 (5.73%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 19 9 10 10 30 1 6 7 1 0 3 3 1 4 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 12 5 0 1 4 2 0 2 7 7 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 0 4 6 1 0 0 4 1 2 1 0 2 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 1 3 0 0 3 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
36 85 72 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
20 66 37 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 99 96 26
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFSIMIMTWLTLALLIQPKLLAFTTTNPPSNKTSLTTKPTPWSWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 10 (18.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 2 2 1 3 3 0 1 1 1 0 0 0 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 2 0 0 0 0 0 0 3 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 2 0 0 2 2 0 0 0 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 18 22 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 26 9 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 21 27 5
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 40 (7.75%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 34 (6.59%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 42 (8.14%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 31 (6.01%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 16 (3.1%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 34 21 4 14 34 6 5 9 1 5 14 15 0 16 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 7 27 11 0 4 14 24 5 3 15 9 4 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 12 3 1 11 10 1 0 4 2 15 0 0 1 13 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
17 8 2 3 13 7 2 0 1 7 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
152 126 134 105
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 139 95 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 234 189 66
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.95%)
Alanine (Ala, A)
n = 16 (7.02%)
Serine (Ser, S)
n = 21 (9.21%)
Threonine (Thr, T)
n = 12 (5.26%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 18 (7.89%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 7 (3.07%)
Proline (Pro, P)
n = 15 (6.58%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 13 (5.7%)
Glutamic acid (Glu, E)
n = 13 (5.7%)
Asparagine (Asn, N)
n = 5 (2.19%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 10 (4.39%)
Lysine (Lys, K)
n = 5 (2.19%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 13 6 2 11 12 3 2 7 0 6 2 7 3 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 4 9 3 0 0 3 4 2 2 5 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 4 1 0 8 8 2 0 3 0 8 1 0 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 2 0 13 5 0 0 2 2 1 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 65 50 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 61 62 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 104 84 25
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 22 (8.46%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 17 (6.54%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 9 (3.46%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 18 (6.92%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 15 8 1 9 15 4 2 6 0 3 5 5 0 1 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 0 14 7 1 0 6 11 2 1 3 7 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 8 2 2 4 7 1 0 5 0 9 0 0 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 7 1 1 4 3 1 0 0 5 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 70 61 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 69 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 128 103 15
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.05%)
Alanine (Ala, A)
n = 34 (8.95%)
Serine (Ser, S)
n = 25 (6.58%)
Threonine (Thr, T)
n = 22 (5.79%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 18 (4.74%)
Leucine (Leu, L)
n = 65 (17.11%)
Isoleucine (Ile, I)
n = 32 (8.42%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 27 (7.11%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 18 (4.74%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 30 8 2 17 31 8 7 7 1 0 6 9 3 2 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 4 22 8 0 1 7 13 2 3 6 14 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 6 0 1 9 11 2 0 2 2 11 1 0 6 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 0 0 9 9 1 1 2 3 2 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
91 111 93 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 104 78 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 185 144 29
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 31 (9.54%)
Serine (Ser, S)
n = 29 (8.92%)
Threonine (Thr, T)
n = 18 (5.54%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 17 (5.23%)
Leucine (Leu, L)
n = 61 (18.77%)
Isoleucine (Ile, I)
n = 19 (5.85%)
Methionine (Met, M)
n = 19 (5.85%)
Proline (Pro, P)
n = 25 (7.69%)
Phenylalanine (Phe, F)
n = 20 (6.15%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 9 (2.77%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 12 15 4 11 38 6 2 4 2 3 9 4 1 7 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 3 4 15 10 2 2 4 5 3 7 8 10 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 11 0 5 6 9 1 0 8 3 11 1 0 1 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 6 5 1 3 7 0 0 1 5 2 0 1 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 100 81 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 95 53 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 120 133 45
ND2 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 39 (11.27%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 65 (18.79%)
Isoleucine (Ile, I)
n = 25 (7.23%)
Methionine (Met, M)
n = 18 (5.2%)
Proline (Pro, P)
n = 23 (6.65%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.18%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 18 13 8 11 29 10 5 8 1 2 4 4 2 2 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 4 22 11 2 0 7 4 0 2 7 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 19 1 2 12 7 3 0 7 0 8 1 2 1 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 1 0 2 13 1 0 2 1 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 102 112 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 123 59 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 143 141 33
ND3 (size: 1041 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.18%)
Alanine (Ala, A)
n = 39 (11.27%)
Serine (Ser, S)
n = 31 (8.96%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 12 (3.47%)
Leucine (Leu, L)
n = 65 (18.79%)
Isoleucine (Ile, I)
n = 25 (7.23%)
Methionine (Met, M)
n = 18 (5.2%)
Proline (Pro, P)
n = 23 (6.65%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 11 (3.18%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 9 (2.6%)
Lysine (Lys, K)
n = 14 (4.05%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 18 13 8 11 29 10 5 8 1 2 4 4 2 2 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 4 22 11 2 0 7 4 0 2 7 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 19 1 2 12 7 3 0 7 0 8 1 2 1 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 1 0 2 13 1 0 2 1 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 102 112 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 123 59 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 143 141 33
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (4.59%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 46 (10.04%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 99 (21.62%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 26 (5.68%)
Proline (Pro, P)
n = 29 (6.33%)
Phenylalanine (Phe, F)
n = 17 (3.71%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 12 (2.62%)
Glutamine (Gln, Q)
n = 14 (3.06%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 32 20 2 18 55 15 8 11 3 2 3 4 1 7 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 3 4 15 12 0 1 9 9 2 1 12 16 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 15 4 4 13 14 0 0 8 2 12 3 1 1 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 1 0 2 9 1 1 2 8 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 158 142 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 137 75 192
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 186 198 38
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 4 1 2 11 2 2 2 0 0 1 4 0 0 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 0 5 0 2 0 4 2 0 0 1 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 0 5 4 2 0 3 0 1 0 0 0 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 28 23 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
15 26 17 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 45 37 7
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 58 (9.59%)
Serine (Ser, S)
n = 39 (6.45%)
Threonine (Thr, T)
n = 63 (10.41%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 22 (3.64%)
Leucine (Leu, L)
n = 99 (16.36%)
Isoleucine (Ile, I)
n = 50 (8.26%)
Methionine (Met, M)
n = 33 (5.45%)
Proline (Pro, P)
n = 32 (5.29%)
Phenylalanine (Phe, F)
n = 34 (5.62%)
Tyrosine (Tyr, Y)
n = 11 (1.82%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 7 (1.16%)
Glutamic acid (Glu, E)
n = 13 (2.15%)
Asparagine (Asn, N)
n = 27 (4.46%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 15 (2.48%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 41 30 5 23 53 14 3 18 1 1 6 13 2 9 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 6 9 33 14 2 2 6 21 4 1 14 17 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
34 21 1 4 11 12 3 1 8 0 11 1 1 3 24 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 5 2 5 20 3 0 3 6 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
133 170 206 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
70 183 115 238
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
40 264 248 54
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.18%)
Alanine (Ala, A)
n = 17 (9.83%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 3 (1.73%)
Cysteine (Cys, C)
n = 3 (1.73%)
Valine (Val, V)
n = 32 (18.5%)
Leucine (Leu, L)
n = 21 (12.14%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 7 (4.05%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 18 (10.4%)
Tyrosine (Tyr, Y)
n = 6 (3.47%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 2 (1.16%)
Asparagine (Asn, N)
n = 3 (1.73%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 5 (2.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 0 2 0 0 4 5 0 0 13 0 3 16 15 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 2 5 0 4 8 6 1 2 19 3 0 0 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 2 1 2 5 1 0 6 0 4 10 3 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 2 2 0 0 1 0 0 0 5 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 16 19 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 34 16 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
83 7 17 67
Total protein-coding genes (size: 11402 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 223 (5.87%)
Alanine (Ala, A)
n = 332 (8.74%)
Serine (Ser, S)
n = 282 (7.42%)
Threonine (Thr, T)
n = 304 (8.0%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 194 (5.11%)
Leucine (Leu, L)
n = 644 (16.95%)
Isoleucine (Ile, I)
n = 279 (7.34%)
Methionine (Met, M)
n = 179 (4.71%)
Proline (Pro, P)
n = 231 (6.08%)
Phenylalanine (Phe, F)
n = 232 (6.11%)
Tyrosine (Tyr, Y)
n = 106 (2.79%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 65 (1.71%)
Glutamic acid (Glu, E)
n = 91 (2.4%)
Asparagine (Asn, N)
n = 125 (3.29%)
Glutamine (Gln, Q)
n = 95 (2.5%)
Histidine (His, H)
n = 110 (2.9%)
Lysine (Lys, K)
n = 90 (2.37%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
57 222 138 44 139 321 76 50 84 11 35 56 73 30 65 167
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
41 4 25 42 183 90 17 17 66 100 40 25 84 112 10 38
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
140 114 12 26 89 92 20 2 53 16 90 13 14 21 104 14
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
96 69 22 9 56 79 11 2 17 42 10 1 2 6 2 94
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
905 1087 1035 773
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
488 1094 690 1528
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
331 1587 1465 417

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.