Viewing data for Canis latrans


Scientific name Canis latrans
Common name Coyote
Maximum lifespan 21.80 years (Canis latrans@AnAge)

Total mtDNA (size: 16724 bases) GC AT G C A T
Base content (bases) 6625 10088 4261 2364 4805 5283
Base content per 1 kb (bases) 396 603 255 141 287 316
Base content (%) 39.6% 60.3%
Total protein-coding genes (size: 11342 bases) GC AT G C A T
Base content (bases) 4507 6835 3044 1463 3361 3474
Base content per 1 kb (bases) 397 603 268 129 296 306
Base content (%) 39.7% 60.3%
D-loop (size: 1265 bases) GC AT G C A T
Base content (bases) 552 702 340 212 364 338
Base content per 1 kb (bases) 436 555 269 168 288 267
Base content (%) 43.6% 55.5%
Total tRNA-coding genes (size: 1515 bases) GC AT G C A T
Base content (bases) 545 970 309 236 445 525
Base content per 1 kb (bases) 360 640 204 156 294 347
Base content (%) 36.0% 64.0%
Total rRNA-coding genes (size: 2534 bases) GC AT G C A T
Base content (bases) 986 1548 544 442 623 925
Base content per 1 kb (bases) 389 611 215 174 246 365
Base content (%) 38.9% 61.1%
12S rRNA gene (size: 955 bases) GC AT G C A T
Base content (bases) 380 575 212 168 230 345
Base content per 1 kb (bases) 398 602 222 176 241 361
Base content (%) 39.8% 60.2%
16S rRNA gene (size: 1579 bases) GC AT G C A T
Base content (bases) 606 973 332 274 393 580
Base content per 1 kb (bases) 384 616 210 174 249 367
Base content (%) 38.4% 61.6%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 273 408 192 81 209 199
Base content per 1 kb (bases) 401 599 282 119 307 292
Base content (%) 40.1% 59.9%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 75 129 59 16 57 72
Base content per 1 kb (bases) 368 632 289 78 279 353
Base content (%) 36.8% 63.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 626 919 351 275 503 416
Base content per 1 kb (bases) 405 595 227 178 326 269
Base content (%) 40.5% 59.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 275 409 179 96 186 223
Base content per 1 kb (bases) 402 598 262 140 272 326
Base content (%) 40.2% 59.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 316 468 197 119 257 211
Base content per 1 kb (bases) 403 597 251 152 328 269
Base content (%) 40.3% 59.7%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 483 657 327 156 317 340
Base content per 1 kb (bases) 424 576 287 137 278 298
Base content (%) 42.4% 57.6%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 393 564 275 118 284 280
Base content per 1 kb (bases) 411 589 287 123 297 293
Base content (%) 41.1% 58.9%
ND2 (size: 1044 bases) GC AT G C A T
Base content (bases) 383 661 289 94 293 368
Base content per 1 kb (bases) 367 633 277 90 281 352
Base content (%) 36.7% 63.3%
ND3 (size: 347 bases) GC AT G C A T
Base content (bases) 150 197 101 49 93 104
Base content per 1 kb (bases) 432 568 291 141 268 300
Base content (%) 43.2% 56.8%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 529 849 381 148 417 432
Base content per 1 kb (bases) 384 616 276 107 303 313
Base content (%) 38.4% 61.6%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 103 194 65 38 102 92
Base content per 1 kb (bases) 347 653 219 128 343 310
Base content (%) 34.7% 65.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 720 1101 498 222 546 555
Base content per 1 kb (bases) 395 605 273 122 300 305
Base content (%) 39.5% 60.5%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 208 320 148 60 116 204
Base content per 1 kb (bases) 394 606 280 114 220 386
Base content (%) 39.4% 60.6%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 22 (9.73%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 19 (8.41%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 42 (18.58%)
Isoleucine (Ile, I)
n = 28 (12.39%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 8 9 6 5 17 1 11 8 1 3 1 5 0 6 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 8 6 7 1 1 3 5 2 3 8 2 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 5 1 2 3 5 0 2 1 2 1 0 2 6 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 3 0 0 1 2 2 0 2 2 1 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 62 76 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 64 38 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 66 85 63
ATP8 (size: 204 bases)
Amino acid sequence: MPQLDTSTWFIMILSMFLTLFILFQLKISNHYYPENPMTKSAKITGQHNPWENKWTKIYSPLSLPPQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.49%)
Alanine (Ala, A)
n = 1 (1.49%)
Serine (Ser, S)
n = 6 (8.96%)
Threonine (Thr, T)
n = 6 (8.96%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 8 (11.94%)
Isoleucine (Ile, I)
n = 6 (8.96%)
Methionine (Met, M)
n = 4 (5.97%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 4 (5.97%)
Tyrosine (Tyr, Y)
n = 3 (4.48%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 1 (1.49%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 4 (5.97%)
Glutamine (Gln, Q)
n = 4 (5.97%)
Histidine (His, H)
n = 2 (2.99%)
Lysine (Lys, K)
n = 5 (7.46%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 3 2 2 3 1 0 3 1 0 0 0 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 0 0 1 0 0 0 3 1 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 1 1 1 1 2 2 0 0 1 2 0 0 1 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 4 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 21 25 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 20 22 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 18 25 18
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 41 (7.98%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 39 (7.59%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 58 (11.28%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 13 22 15 2 16 7 15 4 3 9 5 19 4 19 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 1 0 14 9 17 1 9 9 22 7 12 8 7 1 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 17 2 11 8 5 3 1 2 14 5 3 3 11 6 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 2 5 10 8 1 1 0 6 1 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 101 139 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 96 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
49 115 181 170
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 13 14 4 6 10 3 10 5 2 5 2 5 1 4 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 2 4 2 1 1 2 5 0 2 4 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 6 1 6 4 4 0 1 3 5 6 0 1 1 5 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 12 3 2 8 3 1 0 0 6 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
55 56 67 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 61 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 69 95 48
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 14 (5.38%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 14 (5.38%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 4 9 11 3 8 2 8 5 2 3 2 11 1 15 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 3 9 2 0 2 5 12 2 6 1 3 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 11 0 6 7 4 1 1 2 7 7 1 1 3 4 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 7 1 3 0 2 0 0 2 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 63 58 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 65 57 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 69 96 83
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 28 (7.39%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 20 (5.28%)
Leucine (Leu, L)
n = 56 (14.78%)
Isoleucine (Ile, I)
n = 36 (9.5%)
Methionine (Met, M)
n = 15 (3.96%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 29 (7.65%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 21 14 4 9 27 5 9 5 1 5 5 8 2 8 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 2 6 10 11 1 1 7 16 0 3 6 13 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 12 0 4 6 10 1 1 3 7 7 1 2 6 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 1 2 8 9 0 0 2 6 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 93 108 91
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 96 75 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 138 157 70
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 29 (9.12%)
Serine (Ser, S)
n = 21 (6.6%)
Threonine (Thr, T)
n = 20 (6.29%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 14 (4.4%)
Leucine (Leu, L)
n = 55 (17.3%)
Isoleucine (Ile, I)
n = 30 (9.43%)
Methionine (Met, M)
n = 19 (5.97%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 22 (6.92%)
Tyrosine (Tyr, Y)
n = 11 (3.46%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 13 (4.09%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 13 17 10 10 25 1 7 6 0 4 3 6 1 7 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 3 13 12 1 2 3 4 3 3 10 8 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 7 2 5 5 9 0 1 1 3 8 0 2 6 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 3 1 2 7 0 0 1 7 0 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 86 91 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 90 56 140
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 99 133 71
ND2 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 17 (4.9%)
Serine (Ser, S)
n = 30 (8.65%)
Threonine (Thr, T)
n = 35 (10.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 40 (11.53%)
Methionine (Met, M)
n = 39 (11.24%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 10 (2.88%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 15 (4.32%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 22 33 8 6 25 3 14 9 0 3 2 4 0 2 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 1 11 5 0 1 5 8 1 5 8 7 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 15 1 4 14 9 1 0 2 4 6 1 1 6 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 1 13 2 0 0 3 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 79 147 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 100 62 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 110 159 62
ND3 (size: 1044 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.32%)
Alanine (Ala, A)
n = 17 (4.9%)
Serine (Ser, S)
n = 30 (8.65%)
Threonine (Thr, T)
n = 35 (10.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.59%)
Leucine (Leu, L)
n = 57 (16.43%)
Isoleucine (Ile, I)
n = 40 (11.53%)
Methionine (Met, M)
n = 39 (11.24%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 10 (2.88%)
Tryptophan (Trp, W)
n = 10 (2.88%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.44%)
Asparagine (Asn, N)
n = 16 (4.61%)
Glutamine (Gln, Q)
n = 9 (2.59%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 15 (4.32%)
Arginine (Arg, R)
n = 3 (0.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 22 33 8 6 25 3 14 9 0 3 2 4 0 2 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 0 1 11 5 0 1 5 8 1 5 8 7 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 15 1 4 14 9 1 0 2 4 6 1 1 6 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 0 1 13 2 0 0 3 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
47 79 147 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 100 62 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 110 159 62
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 30 (6.55%)
Serine (Ser, S)
n = 36 (7.86%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 11 (2.4%)
Leucine (Leu, L)
n = 93 (20.31%)
Isoleucine (Ile, I)
n = 44 (9.61%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 19 (4.15%)
Tyrosine (Tyr, Y)
n = 18 (3.93%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 23 (5.02%)
Glutamine (Gln, Q)
n = 10 (2.18%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 19 30 14 19 32 8 15 10 0 3 0 8 0 8 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 5 9 14 2 4 7 6 1 7 8 8 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 16 1 7 11 10 0 3 5 8 10 1 5 10 13 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 7 1 2 1 11 2 3 0 7 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 128 160 101
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 120 86 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 133 186 114
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 9 (9.18%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 10 4 1 10 2 5 2 0 2 0 7 0 4 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 2 1 3 0 0 2 1 1 0 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 4 1 3 1 0 1 1 3 0 0 2 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 23 28 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 20 18 52
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 22 46 24
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (4.95%)
Alanine (Ala, A)
n = 38 (6.27%)
Serine (Ser, S)
n = 51 (8.42%)
Threonine (Thr, T)
n = 54 (8.91%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 23 (3.8%)
Leucine (Leu, L)
n = 89 (14.69%)
Isoleucine (Ile, I)
n = 57 (9.41%)
Methionine (Met, M)
n = 41 (6.77%)
Proline (Pro, P)
n = 24 (3.96%)
Phenylalanine (Phe, F)
n = 43 (7.1%)
Tyrosine (Tyr, Y)
n = 23 (3.8%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 10 (1.65%)
Asparagine (Asn, N)
n = 31 (5.12%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 24 (3.96%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 29 33 20 17 30 4 16 12 7 7 4 10 2 19 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 4 5 18 15 0 3 14 10 3 11 8 5 0 15
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 18 2 10 11 15 2 5 8 7 16 4 2 10 21 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 7 3 5 5 19 5 1 3 5 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
111 136 220 140
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 154 131 253
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
42 208 204 153
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.57%)
Alanine (Ala, A)
n = 11 (6.29%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 12 (6.86%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 21 (12.0%)
Leucine (Leu, L)
n = 21 (12.0%)
Isoleucine (Ile, I)
n = 15 (8.57%)
Methionine (Met, M)
n = 9 (5.14%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 12 (6.86%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 3 3 1 0 2 4 7 0 1 6 1 5 9 12 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 7 1 0 3 8 3 5 6 2 0 1 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 3 1 4 0 1 1 4 1 6 3 1 7 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 5 4 1 1 3 1 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 12 49 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 32 32 78
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
47 16 35 78
Total protein-coding genes (size: 11409 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 216 (5.68%)
Alanine (Ala, A)
n = 257 (6.76%)
Serine (Ser, S)
n = 279 (7.34%)
Threonine (Thr, T)
n = 302 (7.95%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 187 (4.92%)
Leucine (Leu, L)
n = 594 (15.63%)
Isoleucine (Ile, I)
n = 337 (8.87%)
Methionine (Met, M)
n = 251 (6.6%)
Proline (Pro, P)
n = 194 (5.1%)
Phenylalanine (Phe, F)
n = 234 (6.16%)
Tyrosine (Tyr, Y)
n = 142 (3.74%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 94 (2.47%)
Asparagine (Asn, N)
n = 160 (4.21%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 96 (2.53%)
Lysine (Lys, K)
n = 100 (2.63%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
181 156 203 105 83 217 44 118 71 18 51 25 91 20 109 125
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
48 7 18 59 92 94 12 34 60 96 26 58 66 66 4 79
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
95 116 12 66 73 78 12 19 31 65 77 13 27 68 92 42
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
54 74 20 25 41 80 20 6 11 46 2 1 0 8 1 91
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
820 893 1201 888
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
461 982 756 1603
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
279 1099 1450 974

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.