Viewing data for Ara glaucogularis


Scientific name Ara glaucogularis
Common name Blue-throated macaw
Maximum lifespan 22.00 years (Ara glaucogularis@AnAge)

Total mtDNA (size: 16983 bases) GC AT G C A T
Base content (bases) 7885 9098 5479 2406 3979 5119
Base content per 1 kb (bases) 464 536 323 142 234 301
Base content (%) 46.4% 53.6%
Total protein-coding genes (size: 11380 bases) GC AT G C A T
Base content (bases) 5287 6093 3843 1444 2698 3395
Base content per 1 kb (bases) 465 535 338 127 237 298
Base content (%) 46.5% 53.5%
D-loop (size: 1485 bases) GC AT G C A T
Base content (bases) 656 829 435 221 451 378
Base content per 1 kb (bases) 442 558 293 149 304 255
Base content (%) 44.2% 55.8%
Total tRNA-coding genes (size: 1530 bases) GC AT G C A T
Base content (bases) 669 861 400 269 366 495
Base content per 1 kb (bases) 437 563 261 176 239 324
Base content (%) 43.7% 56.3%
Total rRNA-coding genes (size: 2538 bases) GC AT G C A T
Base content (bases) 1252 1286 778 474 454 832
Base content per 1 kb (bases) 493 507 307 187 179 328
Base content (%) 49.3% 50.7%
12S rRNA gene (size: 972 bases) GC AT G C A T
Base content (bases) 487 485 304 183 170 315
Base content per 1 kb (bases) 501 499 313 188 175 324
Base content (%) 50.1% 49.9%
16S rRNA gene (size: 1566 bases) GC AT G C A T
Base content (bases) 765 801 474 291 284 517
Base content per 1 kb (bases) 489 511 303 186 181 330
Base content (%) 48.9% 51.1%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 316 368 246 70 166 202
Base content per 1 kb (bases) 462 538 360 102 243 295
Base content (%) 46.2% 53.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 74 94 63 11 38 56
Base content per 1 kb (bases) 440 560 375 65 226 333
Base content (%) 44.0% 56.0%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 742 806 469 273 385 421
Base content per 1 kb (bases) 479 521 303 176 249 272
Base content (%) 47.9% 52.1%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 327 357 228 99 156 201
Base content per 1 kb (bases) 478 522 333 145 228 294
Base content (%) 47.8% 52.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 371 413 248 123 195 218
Base content per 1 kb (bases) 473 527 316 157 249 278
Base content (%) 47.3% 52.7%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 526 614 386 140 295 319
Base content per 1 kb (bases) 461 539 339 123 259 280
Base content (%) 46.1% 53.9%
ND1 (size: 981 bases) GC AT G C A T
Base content (bases) 463 518 337 126 257 261
Base content per 1 kb (bases) 472 528 344 128 262 266
Base content (%) 47.2% 52.8%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 450 590 361 89 254 336
Base content per 1 kb (bases) 433 567 347 86 244 323
Base content (%) 43.3% 56.7%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 151 200 110 41 95 105
Base content per 1 kb (bases) 430 570 313 117 271 299
Base content (%) 43.0% 57.0%
ND4 (size: 1393 bases) GC AT G C A T
Base content (bases) 648 745 496 152 336 409
Base content per 1 kb (bases) 465 535 356 109 241 294
Base content (%) 46.5% 53.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 138 159 96 42 78 81
Base content per 1 kb (bases) 465 535 323 141 263 273
Base content (%) 46.5% 53.5%
ND5 (size: 1815 bases) GC AT G C A T
Base content (bases) 838 977 615 223 401 576
Base content per 1 kb (bases) 462 538 339 123 221 317
Base content (%) 46.2% 53.8%
ND6 (size: 513 bases) GC AT G C A T
Base content (bases) 248 265 191 57 47 218
Base content per 1 kb (bases) 483 517 372 111 92 425
Base content (%) 48.3% 51.7%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 11 (4.85%)
Threonine (Thr, T)
n = 26 (11.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 59 (25.99%)
Isoleucine (Ile, I)
n = 23 (10.13%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 18 (7.93%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 20 6 7 17 27 2 4 8 0 1 2 6 0 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 9 4 0 1 4 3 1 6 4 8 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 13 0 1 2 5 0 1 2 3 1 0 2 2 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 1 0 1 2 1 0 3 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 87 73 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 68 33 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 91 96 31
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWLFIMTMSWLTFSLIFQPKTLSFTSTNPPINKTSTATKNHPWTWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 6 (10.91%)
Threonine (Thr, T)
n = 9 (16.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 5 (9.09%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 2 1 1 1 0 2 1 1 0 0 0 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 0 0 0 2 5 1 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 4 1 1 3 1 1 0 0 0 0 0 0 0 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 0 2 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 14 23 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 24 12 15
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 25 21 5
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.13%)
Alanine (Ala, A)
n = 46 (8.93%)
Serine (Ser, S)
n = 27 (5.24%)
Threonine (Thr, T)
n = 41 (7.96%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.57%)
Leucine (Leu, L)
n = 65 (12.62%)
Isoleucine (Ile, I)
n = 35 (6.8%)
Methionine (Met, M)
n = 23 (4.47%)
Proline (Pro, P)
n = 30 (5.83%)
Phenylalanine (Phe, F)
n = 40 (7.77%)
Tyrosine (Tyr, Y)
n = 18 (3.5%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 16 (3.11%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 29 17 7 10 34 2 11 8 2 6 12 18 3 7 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 8 22 14 2 6 10 20 11 5 9 15 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 19 1 4 11 9 0 0 3 8 10 2 1 4 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 6 4 2 13 6 3 2 1 5 0 0 1 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
157 119 128 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 141 96 202
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 209 197 71
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 12 (5.29%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 12 (5.29%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 14 (6.17%)
Glutamic acid (Glu, E)
n = 14 (6.17%)
Asparagine (Asn, N)
n = 4 (1.76%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 15 10 2 11 11 4 5 6 1 3 4 5 0 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 2 10 0 0 0 2 4 2 2 4 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 6 1 2 7 7 1 1 2 2 5 2 0 0 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 11 3 2 12 4 0 0 3 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 62 59 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 61 59 84
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 105 83 25
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 19 (7.31%)
Serine (Ser, S)
n = 17 (6.54%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 36 (13.85%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 12 5 3 10 16 1 6 9 0 4 4 7 0 3 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 1 7 10 1 2 5 9 5 1 6 4 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 0 3 4 6 0 1 3 3 7 0 0 0 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 6 2 2 2 3 0 0 0 3 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 72 57 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 70 54 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 106 107 34
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (5.8%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 27 (7.12%)
Threonine (Thr, T)
n = 29 (7.65%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 13 (3.43%)
Leucine (Leu, L)
n = 67 (17.68%)
Isoleucine (Ile, I)
n = 32 (8.44%)
Methionine (Met, M)
n = 8 (2.11%)
Proline (Pro, P)
n = 25 (6.6%)
Phenylalanine (Phe, F)
n = 30 (7.92%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 11 (2.9%)
Aspartic acid (Asp, D)
n = 6 (1.58%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 21 (5.54%)
Glutamine (Gln, Q)
n = 7 (1.85%)
Histidine (His, H)
n = 13 (3.43%)
Lysine (Lys, K)
n = 10 (2.64%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 27 6 3 15 34 4 11 5 2 1 3 8 1 8 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 2 5 15 6 0 3 7 9 3 3 14 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 9 1 3 10 10 0 0 4 7 6 1 0 1 20 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 2 1 5 10 0 1 1 5 1 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 109 104 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 103 78 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 174 137 52
ND1 (size: 981 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.99%)
Alanine (Ala, A)
n = 25 (7.67%)
Serine (Ser, S)
n = 34 (10.43%)
Threonine (Thr, T)
n = 24 (7.36%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (4.29%)
Leucine (Leu, L)
n = 70 (21.47%)
Isoleucine (Ile, I)
n = 19 (5.83%)
Methionine (Met, M)
n = 13 (3.99%)
Proline (Pro, P)
n = 26 (7.98%)
Phenylalanine (Phe, F)
n = 16 (4.91%)
Tyrosine (Tyr, Y)
n = 15 (4.6%)
Tryptophan (Trp, W)
n = 9 (2.76%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.37%)
Asparagine (Asn, N)
n = 10 (3.07%)
Glutamine (Gln, Q)
n = 5 (1.53%)
Histidine (His, H)
n = 3 (0.92%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 15 11 13 22 23 2 9 5 0 3 4 7 0 4 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 4 9 11 1 5 2 6 0 3 13 10 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 2 4 13 9 0 0 8 5 10 2 1 0 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 8 3 1 3 3 4 1 1 4 2 0 1 0 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 102 82 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 101 55 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 134 124 49
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 21 (6.09%)
Serine (Ser, S)
n = 36 (10.43%)
Threonine (Thr, T)
n = 53 (15.36%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 61 (17.68%)
Isoleucine (Ile, I)
n = 34 (9.86%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 23 (6.67%)
Phenylalanine (Phe, F)
n = 13 (3.77%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 7 (2.03%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 8 (2.32%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 24 17 4 17 32 0 6 7 2 2 1 2 0 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 4 10 6 1 4 3 3 2 2 11 10 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 23 0 5 12 15 0 2 2 1 5 1 2 1 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 1 1 0 10 1 0 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 96 133 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 129 54 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 136 148 50
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 21 (6.09%)
Serine (Ser, S)
n = 36 (10.43%)
Threonine (Thr, T)
n = 53 (15.36%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 61 (17.68%)
Isoleucine (Ile, I)
n = 34 (9.86%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 23 (6.67%)
Phenylalanine (Phe, F)
n = 13 (3.77%)
Tyrosine (Tyr, Y)
n = 6 (1.74%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 7 (2.03%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 8 (2.32%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 24 17 4 17 32 0 6 7 2 2 1 2 0 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 4 10 6 1 4 3 3 2 2 11 10 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 23 0 5 12 15 0 2 2 1 5 1 2 1 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 1 1 0 10 1 0 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
46 96 133 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 129 54 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 136 148 50
ND4 (size: 1393 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.89%)
Alanine (Ala, A)
n = 30 (6.48%)
Serine (Ser, S)
n = 38 (8.21%)
Threonine (Thr, T)
n = 54 (11.66%)
Cysteine (Cys, C)
n = 6 (1.3%)
Valine (Val, V)
n = 10 (2.16%)
Leucine (Leu, L)
n = 101 (21.81%)
Isoleucine (Ile, I)
n = 34 (7.34%)
Methionine (Met, M)
n = 26 (5.62%)
Proline (Pro, P)
n = 36 (7.78%)
Phenylalanine (Phe, F)
n = 11 (2.38%)
Tyrosine (Tyr, Y)
n = 13 (2.81%)
Tryptophan (Trp, W)
n = 11 (2.38%)
Aspartic acid (Asp, D)
n = 2 (0.43%)
Glutamic acid (Glu, E)
n = 9 (1.94%)
Asparagine (Asn, N)
n = 11 (2.38%)
Glutamine (Gln, Q)
n = 15 (3.24%)
Histidine (His, H)
n = 18 (3.89%)
Lysine (Lys, K)
n = 11 (2.38%)
Arginine (Arg, R)
n = 10 (2.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 26 20 20 23 43 3 11 11 4 2 4 4 0 2 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 3 3 6 15 9 0 2 6 8 2 8 15 13 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 26 1 4 11 10 1 1 11 5 8 2 1 2 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 7 2 0 2 7 4 3 3 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 168 148 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 146 79 182
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 182 182 74
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 15 (15.31%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 3 (3.06%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (3.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 5 1 5 7 2 4 3 0 0 1 1 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 2 0 6 2 0 0 2 2 0 1 0 1 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 7 0 4 4 3 0 2 2 0 2 0 1 0 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 2 0 1 0 0 0 1 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 27 25 29
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 30 16 37
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 39 40 12
ND5 (size: 1815 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.3%)
Alanine (Ala, A)
n = 49 (8.11%)
Serine (Ser, S)
n = 46 (7.62%)
Threonine (Thr, T)
n = 74 (12.25%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 14 (2.32%)
Leucine (Leu, L)
n = 109 (18.05%)
Isoleucine (Ile, I)
n = 47 (7.78%)
Methionine (Met, M)
n = 32 (5.3%)
Proline (Pro, P)
n = 32 (5.3%)
Phenylalanine (Phe, F)
n = 31 (5.13%)
Tyrosine (Tyr, Y)
n = 12 (1.99%)
Tryptophan (Trp, W)
n = 11 (1.82%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 12 (1.99%)
Asparagine (Asn, N)
n = 23 (3.81%)
Glutamine (Gln, Q)
n = 18 (2.98%)
Histidine (His, H)
n = 14 (2.32%)
Lysine (Lys, K)
n = 26 (4.3%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 35 24 10 24 63 3 6 17 1 2 5 2 5 5 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 4 11 26 12 0 0 11 14 7 3 13 16 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
34 35 1 4 17 11 2 0 12 4 8 1 3 3 20 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 4 1 8 25 1 1 1 4 2 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
116 172 214 103
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 189 115 233
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 254 247 65
ND6 (size: 513 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.47%)
Alanine (Ala, A)
n = 12 (7.06%)
Serine (Ser, S)
n = 14 (8.24%)
Threonine (Thr, T)
n = 3 (1.76%)
Cysteine (Cys, C)
n = 2 (1.18%)
Valine (Val, V)
n = 35 (20.59%)
Leucine (Leu, L)
n = 25 (14.71%)
Isoleucine (Ile, I)
n = 1 (0.59%)
Methionine (Met, M)
n = 5 (2.94%)
Proline (Pro, P)
n = 5 (2.94%)
Phenylalanine (Phe, F)
n = 15 (8.82%)
Tyrosine (Tyr, Y)
n = 6 (3.53%)
Tryptophan (Trp, W)
n = 6 (3.53%)
Aspartic acid (Asp, D)
n = 3 (1.76%)
Glutamic acid (Glu, E)
n = 1 (0.59%)
Asparagine (Asn, N)
n = 1 (0.59%)
Glutamine (Gln, Q)
n = 1 (0.59%)
Histidine (His, H)
n = 2 (1.18%)
Lysine (Lys, K)
n = 1 (0.59%)
Arginine (Arg, R)
n = 4 (2.35%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 1 3 0 1 3 4 1 0 17 2 2 14 14 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 5 1 3 3 10 1 1 16 2 1 1 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 0 0 8 0 1 1 4 0 6 0 6 14 1 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 1 3 0 0 1 0 0 1 3 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
79 19 15 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 30 16 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
68 8 16 79
Total protein-coding genes (size: 11397 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 219 (5.77%)
Alanine (Ala, A)
n = 272 (7.17%)
Serine (Ser, S)
n = 298 (7.85%)
Threonine (Thr, T)
n = 376 (9.91%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 170 (4.48%)
Leucine (Leu, L)
n = 676 (17.81%)
Isoleucine (Ile, I)
n = 275 (7.24%)
Methionine (Met, M)
n = 168 (4.43%)
Proline (Pro, P)
n = 240 (6.32%)
Phenylalanine (Phe, F)
n = 211 (5.56%)
Tyrosine (Tyr, Y)
n = 108 (2.85%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 63 (1.66%)
Glutamic acid (Glu, E)
n = 92 (2.42%)
Asparagine (Asn, N)
n = 121 (3.19%)
Glutamine (Gln, Q)
n = 97 (2.56%)
Histidine (His, H)
n = 108 (2.85%)
Lysine (Lys, K)
n = 90 (2.37%)
Arginine (Arg, R)
n = 68 (1.79%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
59 216 129 77 161 304 26 83 84 13 41 43 63 23 55 156
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
39 14 15 51 134 79 8 33 53 83 50 39 96 100 5 34
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
167 167 8 45 96 89 6 12 50 44 64 18 25 14 107 25
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
83 65 27 13 50 74 16 8 15 36 9 0 2 5 2 89
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
816 1081 1094 806
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
487 1124 686 1500
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
277 1506 1450 564

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.