Viewing data for Alouatta caraya


Scientific name Alouatta caraya
Common name Black howler monkey
Maximum lifespan 32.40 years (Alouatta caraya@AnAge)

Total mtDNA (size: 16517 bases) GC AT G C A T
Base content (bases) 6544 9973 4425 2119 4584 5389
Base content per 1 kb (bases) 396 604 268 128 278 326
Base content (%) 39.6% 60.4%
Total protein-coding genes (size: 11332 bases) GC AT G C A T
Base content (bases) 4485 6847 3197 1288 3248 3599
Base content per 1 kb (bases) 396 604 282 114 287 318
Base content (%) 39.6% 60.4%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1495 bases) GC AT G C A T
Base content (bases) 540 955 322 218 421 534
Base content per 1 kb (bases) 361 639 215 146 282 357
Base content (%) 36.1% 63.9%
Total rRNA-coding genes (size: 2480 bases) GC AT G C A T
Base content (bases) 1003 1477 578 425 609 868
Base content per 1 kb (bases) 404 596 233 171 246 350
Base content (%) 40.4% 59.6%
12S rRNA gene (size: 946 bases) GC AT G C A T
Base content (bases) 391 555 219 172 228 327
Base content per 1 kb (bases) 413 587 232 182 241 346
Base content (%) 41.3% 58.7%
16S rRNA gene (size: 1534 bases) GC AT G C A T
Base content (bases) 612 922 359 253 381 541
Base content per 1 kb (bases) 399 601 234 165 248 353
Base content (%) 39.9% 60.1%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 266 415 203 63 193 222
Base content per 1 kb (bases) 391 609 298 93 283 326
Base content (%) 39.1% 60.9%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 64 137 50 14 58 79
Base content per 1 kb (bases) 318 682 249 70 289 393
Base content (%) 31.8% 68.2%
COX1 (size: 1540 bases) GC AT G C A T
Base content (bases) 622 918 379 243 490 428
Base content per 1 kb (bases) 404 596 246 158 318 278
Base content (%) 40.4% 59.6%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 279 409 187 92 192 217
Base content per 1 kb (bases) 406 594 272 134 279 315
Base content (%) 40.6% 59.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 332 452 217 115 227 225
Base content per 1 kb (bases) 423 577 277 147 290 287
Base content (%) 42.3% 57.7%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 500 640 367 133 305 335
Base content per 1 kb (bases) 439 561 322 117 268 294
Base content (%) 43.9% 56.1%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 375 581 269 106 276 305
Base content per 1 kb (bases) 392 608 281 111 289 319
Base content (%) 39.2% 60.8%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 395 644 315 80 280 364
Base content per 1 kb (bases) 380 620 303 77 269 350
Base content (%) 38.0% 62.0%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 127 219 92 35 102 117
Base content per 1 kb (bases) 367 633 266 101 295 338
Base content (%) 36.7% 63.3%
ND4 (size: 1372 bases) GC AT G C A T
Base content (bases) 518 854 384 134 407 447
Base content per 1 kb (bases) 378 622 280 98 297 326
Base content (%) 37.8% 62.2%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 111 186 75 36 97 89
Base content per 1 kb (bases) 374 626 253 121 327 300
Base content (%) 37.4% 62.6%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 711 1095 523 188 519 576
Base content per 1 kb (bases) 394 606 290 104 287 319
Base content (%) 39.4% 60.6%
ND6 (size: 534 bases) GC AT G C A T
Base content (bases) 199 335 146 53 119 216
Base content per 1 kb (bases) 373 627 273 99 223 404
Base content (%) 37.3% 62.7%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.54%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 18 (7.96%)
Threonine (Thr, T)
n = 23 (10.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (4.87%)
Leucine (Leu, L)
n = 46 (20.35%)
Isoleucine (Ile, I)
n = 23 (10.18%)
Methionine (Met, M)
n = 16 (7.08%)
Proline (Pro, P)
n = 11 (4.87%)
Phenylalanine (Phe, F)
n = 9 (3.98%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 2 (0.88%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 5 (2.21%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 13 13 9 7 23 1 6 8 1 3 3 5 0 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 9 6 0 2 0 5 1 2 5 4 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 14 0 3 9 3 0 2 1 1 3 0 0 6 5 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 1 5 0 0 0 4 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
39 69 81 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
18 65 39 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 69 102 50
ATP8 (size: 201 bases)
Amino acid sequence: VPQLDMSPWPMVIMSMILTLFYITQLKILNFTFHVTPSSKLTMPHKHKTTWELKWTKIYLPPSMYQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 5 (7.58%)
Threonine (Thr, T)
n = 8 (12.12%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (4.55%)
Leucine (Leu, L)
n = 8 (12.12%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 6 (9.09%)
Proline (Pro, P)
n = 7 (10.61%)
Phenylalanine (Phe, F)
n = 3 (4.55%)
Tyrosine (Tyr, Y)
n = 3 (4.55%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 1 (1.52%)
Asparagine (Asn, N)
n = 1 (1.52%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 3 (4.55%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 0 5 0 0 4 1 2 3 0 0 1 1 1 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 3 0 3 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 1 0 0 0 5 0 0 0 1 2 0 1 0 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 0 0 1 5 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 18 26 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 20 19 25
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 12 34 15
COX1 (size: 1540 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.79%)
Alanine (Ala, A)
n = 34 (6.64%)
Serine (Ser, S)
n = 35 (6.84%)
Threonine (Thr, T)
n = 41 (8.01%)
Cysteine (Cys, C)
n = 1 (0.2%)
Valine (Val, V)
n = 35 (6.84%)
Leucine (Leu, L)
n = 62 (12.11%)
Isoleucine (Ile, I)
n = 40 (7.81%)
Methionine (Met, M)
n = 28 (5.47%)
Proline (Pro, P)
n = 29 (5.66%)
Phenylalanine (Phe, F)
n = 41 (8.01%)
Tyrosine (Tyr, Y)
n = 20 (3.91%)
Tryptophan (Trp, W)
n = 16 (3.13%)
Aspartic acid (Asp, D)
n = 15 (2.93%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.32%)
Glutamine (Gln, Q)
n = 7 (1.37%)
Histidine (His, H)
n = 19 (3.71%)
Lysine (Lys, K)
n = 10 (1.95%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 10 23 11 8 23 7 11 4 3 6 8 20 1 23 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 7 14 12 1 11 11 16 7 13 7 9 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 21 0 11 6 14 0 3 1 12 8 2 2 11 6 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 9 1 5 10 10 0 1 2 4 1 0 0 0 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
139 112 140 122
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 135 98 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 132 190 161
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 17 (7.46%)
Serine (Ser, S)
n = 18 (7.89%)
Threonine (Thr, T)
n = 13 (5.7%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 9 (3.95%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 23 (10.09%)
Methionine (Met, M)
n = 13 (5.7%)
Proline (Pro, P)
n = 12 (5.26%)
Phenylalanine (Phe, F)
n = 11 (4.82%)
Tyrosine (Tyr, Y)
n = 13 (5.7%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 10 (4.39%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 6 (2.63%)
Glutamine (Gln, Q)
n = 8 (3.51%)
Histidine (His, H)
n = 7 (3.07%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 9 10 6 3 14 1 5 8 0 2 2 4 1 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 4 8 5 0 0 4 2 2 5 3 4 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 6 0 0 5 9 0 1 3 5 8 0 1 2 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 13 1 3 7 4 0 1 2 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 57 63 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 56 62 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 74 92 54
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 17 (6.54%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 13 (5.0%)
Leucine (Leu, L)
n = 29 (11.15%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 13 (5.0%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 5 7 5 3 13 1 7 8 1 2 4 5 2 13 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 3 12 6 0 1 9 9 1 2 3 7 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 14 0 4 3 6 0 0 4 9 4 0 0 1 4 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 8 0 2 1 2 0 0 1 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 64 61 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 71 56 91
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 82 108 64
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.07%)
Alanine (Ala, A)
n = 21 (5.54%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 38 (10.03%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 10 (2.64%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 43 (11.35%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 4 (1.06%)
Asparagine (Asn, N)
n = 14 (3.69%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 11 (2.9%)
Arginine (Arg, R)
n = 7 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 24 12 6 17 28 3 4 8 0 1 5 4 0 11 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 3 13 5 0 4 10 5 4 3 9 10 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 18 0 2 7 13 0 1 3 3 11 0 1 2 12 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 3 1 3 9 8 3 0 2 5 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 102 124 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 103 75 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 162 136 68
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 27 (8.52%)
Serine (Ser, S)
n = 26 (8.2%)
Threonine (Thr, T)
n = 26 (8.2%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 10 (3.15%)
Leucine (Leu, L)
n = 59 (18.61%)
Isoleucine (Ile, I)
n = 21 (6.62%)
Methionine (Met, M)
n = 23 (7.26%)
Proline (Pro, P)
n = 21 (6.62%)
Phenylalanine (Phe, F)
n = 18 (5.68%)
Tyrosine (Tyr, Y)
n = 15 (4.73%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 14 (4.42%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 6 (1.89%)
Arginine (Arg, R)
n = 7 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 8 23 7 9 26 1 15 6 0 1 4 2 3 10 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 1 4 10 12 1 1 8 3 0 5 7 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 14 0 3 5 14 0 1 3 12 3 1 1 2 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 11 0 1 2 4 2 0 1 5 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 80 94 81
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 96 58 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 93 152 63
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 17 (4.93%)
Serine (Ser, S)
n = 28 (8.12%)
Threonine (Thr, T)
n = 40 (11.59%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 33 (9.57%)
Methionine (Met, M)
n = 32 (9.28%)
Proline (Pro, P)
n = 23 (6.67%)
Phenylalanine (Phe, F)
n = 11 (3.19%)
Tyrosine (Tyr, Y)
n = 10 (2.9%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 19 (5.51%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 16 31 10 11 34 2 8 10 0 0 1 6 0 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 9 6 0 1 5 4 2 5 9 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 20 2 3 12 9 1 1 2 2 8 0 1 9 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 2 11 0 1 2 0 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 100 138 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 105 63 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 110 163 64
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 17 (4.93%)
Serine (Ser, S)
n = 28 (8.12%)
Threonine (Thr, T)
n = 40 (11.59%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (2.03%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 33 (9.57%)
Methionine (Met, M)
n = 32 (9.28%)
Proline (Pro, P)
n = 23 (6.67%)
Phenylalanine (Phe, F)
n = 11 (3.19%)
Tyrosine (Tyr, Y)
n = 10 (2.9%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 19 (5.51%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 16 31 10 11 34 2 8 10 0 0 1 6 0 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 2 9 6 0 1 5 4 2 5 9 9 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 20 2 3 12 9 1 1 2 2 8 0 1 9 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 2 11 0 1 2 0 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 100 138 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 105 63 149
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 110 163 64
ND4 (size: 1372 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.17%)
Alanine (Ala, A)
n = 28 (6.14%)
Serine (Ser, S)
n = 34 (7.46%)
Threonine (Thr, T)
n = 39 (8.55%)
Cysteine (Cys, C)
n = 5 (1.1%)
Valine (Val, V)
n = 5 (1.1%)
Leucine (Leu, L)
n = 99 (21.71%)
Isoleucine (Ile, I)
n = 41 (8.99%)
Methionine (Met, M)
n = 38 (8.33%)
Proline (Pro, P)
n = 26 (5.7%)
Phenylalanine (Phe, F)
n = 20 (4.39%)
Tyrosine (Tyr, Y)
n = 15 (3.29%)
Tryptophan (Trp, W)
n = 12 (2.63%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 25 (5.48%)
Glutamine (Gln, Q)
n = 8 (1.75%)
Histidine (His, H)
n = 10 (2.19%)
Lysine (Lys, K)
n = 12 (2.63%)
Arginine (Arg, R)
n = 10 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 20 34 16 19 36 3 24 7 1 2 1 2 0 10 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 4 5 12 10 1 7 3 5 4 4 11 11 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 19 0 4 6 15 0 2 7 5 10 2 1 13 12 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 9 0 1 1 12 0 0 2 8 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 128 164 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 118 81 203
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 138 202 101
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 4 (4.08%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 25 (25.51%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 5 (5.1%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 7 3 0 16 1 4 2 0 1 0 3 1 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 2 0 4 3 0 1 1 2 0 1 1 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 1 2 3 1 0 0 2 3 0 1 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 1 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 27 26 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 21 18 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 27 45 19
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.49%)
Alanine (Ala, A)
n = 39 (6.49%)
Serine (Ser, S)
n = 58 (9.65%)
Threonine (Thr, T)
n = 54 (8.99%)
Cysteine (Cys, C)
n = 3 (0.5%)
Valine (Val, V)
n = 15 (2.5%)
Leucine (Leu, L)
n = 90 (14.98%)
Isoleucine (Ile, I)
n = 63 (10.48%)
Methionine (Met, M)
n = 38 (6.32%)
Proline (Pro, P)
n = 31 (5.16%)
Phenylalanine (Phe, F)
n = 44 (7.32%)
Tyrosine (Tyr, Y)
n = 14 (2.33%)
Tryptophan (Trp, W)
n = 12 (2.0%)
Aspartic acid (Asp, D)
n = 10 (1.66%)
Glutamic acid (Glu, E)
n = 10 (1.66%)
Asparagine (Asn, N)
n = 31 (5.16%)
Glutamine (Gln, Q)
n = 17 (2.83%)
Histidine (His, H)
n = 17 (2.83%)
Lysine (Lys, K)
n = 20 (3.33%)
Arginine (Arg, R)
n = 8 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 32 29 19 12 27 1 29 17 0 2 3 10 0 20 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 2 1 6 18 15 0 1 14 12 0 2 19 10 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 23 2 5 14 22 2 1 14 4 10 2 2 12 19 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 2 2 8 18 2 1 3 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
101 132 221 148
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 167 120 250
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 224 235 121
ND6 (size: 534 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.69%)
Alanine (Ala, A)
n = 12 (6.78%)
Serine (Ser, S)
n = 11 (6.21%)
Threonine (Thr, T)
n = 9 (5.08%)
Cysteine (Cys, C)
n = 3 (1.69%)
Valine (Val, V)
n = 21 (11.86%)
Leucine (Leu, L)
n = 19 (10.73%)
Isoleucine (Ile, I)
n = 12 (6.78%)
Methionine (Met, M)
n = 14 (7.91%)
Proline (Pro, P)
n = 6 (3.39%)
Phenylalanine (Phe, F)
n = 9 (5.08%)
Tyrosine (Tyr, Y)
n = 9 (5.08%)
Tryptophan (Trp, W)
n = 4 (2.26%)
Aspartic acid (Asp, D)
n = 5 (2.82%)
Glutamic acid (Glu, E)
n = 7 (3.95%)
Asparagine (Asn, N)
n = 3 (1.69%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.13%)
Lysine (Lys, K)
n = 3 (1.69%)
Arginine (Arg, R)
n = 2 (1.13%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 1 7 2 0 0 0 12 0 0 11 1 5 4 9 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 3 0 6 0 2 4 12 3 4 7 4 1 1 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 3 1 4 0 3 0 3 1 9 0 2 5 3 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 4 5 0 1 2 2 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 12 45 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 34 30 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 7 44 91
Total protein-coding genes (size: 11384 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 207 (5.46%)
Alanine (Ala, A)
n = 247 (6.52%)
Serine (Ser, S)
n = 285 (7.52%)
Threonine (Thr, T)
n = 338 (8.92%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 147 (3.88%)
Leucine (Leu, L)
n = 619 (16.33%)
Isoleucine (Ile, I)
n = 335 (8.84%)
Methionine (Met, M)
n = 243 (6.41%)
Proline (Pro, P)
n = 208 (5.49%)
Phenylalanine (Phe, F)
n = 230 (6.07%)
Tyrosine (Tyr, Y)
n = 138 (3.64%)
Tryptophan (Trp, W)
n = 103 (2.72%)
Aspartic acid (Asp, D)
n = 69 (1.82%)
Glutamic acid (Glu, E)
n = 87 (2.29%)
Asparagine (Asn, N)
n = 158 (4.17%)
Glutamine (Gln, Q)
n = 90 (2.37%)
Histidine (His, H)
n = 103 (2.72%)
Lysine (Lys, K)
n = 93 (2.45%)
Arginine (Arg, R)
n = 61 (1.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
192 143 203 95 93 258 22 135 84 6 33 33 68 13 119 111
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
40 10 15 41 114 84 8 41 68 69 29 49 79 79 1 59
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
109 165 5 41 69 117 4 15 39 67 71 10 16 65 93 40
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
63 76 11 24 45 82 11 6 15 38 2 0 0 6 0 93
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
757 930 1221 884
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
450 1024 744 1574
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
178 1160 1557 897

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.