Viewing data for Turdus migratorius


Scientific name Turdus migratorius
Common name American robin
Maximum lifespan 17.00 years (Turdus migratorius@AnAge)

Total mtDNA (size: 16669 bases) GC AT G C A T
Base content (bases) 7951 8638 5435 2516 3822 4816
Base content per 1 kb (bases) 477 518 326 151 229 289
Base content (%) 47.7% 51.8%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5559 5741 3996 1563 2574 3167
Base content per 1 kb (bases) 489 505 351 137 226 278
Base content (%) 48.9% 50.5%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1546 bases) GC AT G C A T
Base content (bases) 666 880 391 275 383 497
Base content per 1 kb (bases) 431 569 253 178 248 321
Base content (%) 43.1% 56.9%
Total rRNA-coding genes (size: 2563 bases) GC AT G C A T
Base content (bases) 1182 1381 654 528 535 846
Base content per 1 kb (bases) 461 539 255 206 209 330
Base content (%) 46.1% 53.9%
12S rRNA gene (size: 973 bases) GC AT G C A T
Base content (bases) 477 496 265 212 200 296
Base content per 1 kb (bases) 490 510 272 218 206 304
Base content (%) 49.0% 51.0%
16S rRNA gene (size: 1590 bases) GC AT G C A T
Base content (bases) 705 885 389 316 335 550
Base content per 1 kb (bases) 443 557 245 199 211 346
Base content (%) 44.3% 55.7%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 332 352 253 79 161 191
Base content per 1 kb (bases) 485 515 370 115 235 279
Base content (%) 48.5% 51.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 77 91 66 11 42 49
Base content per 1 kb (bases) 458 542 393 65 250 292
Base content (%) 45.8% 54.2%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 781 770 502 279 371 399
Base content per 1 kb (bases) 504 496 324 180 239 257
Base content (%) 50.4% 49.6%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 336 348 228 108 152 196
Base content per 1 kb (bases) 491 509 333 158 222 287
Base content (%) 49.1% 50.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 396 388 268 128 196 192
Base content per 1 kb (bases) 505 495 342 163 250 245
Base content (%) 50.5% 49.5%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 549 594 391 158 271 323
Base content per 1 kb (bases) 480 520 342 138 237 283
Base content (%) 48.0% 52.0%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 488 490 339 149 243 247
Base content per 1 kb (bases) 499 501 347 152 248 253
Base content (%) 49.9% 50.1%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 495 545 369 126 242 303
Base content per 1 kb (bases) 476 524 355 121 233 291
Base content (%) 47.6% 52.4%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 139 134 88 51 70 64
Base content per 1 kb (bases) 396 382 251 145 199 182
Base content (%) 39.6% 38.2%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 680 698 522 158 302 396
Base content per 1 kb (bases) 493 507 379 115 219 287
Base content (%) 49.3% 50.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 151 146 114 37 68 78
Base content per 1 kb (bases) 508 492 384 125 229 263
Base content (%) 50.8% 49.2%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 864 954 644 220 419 535
Base content per 1 kb (bases) 475 525 354 121 230 294
Base content (%) 47.5% 52.5%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 275 244 214 61 42 202
Base content per 1 kb (bases) 530 470 412 118 81 389
Base content (%) 53.0% 47.0%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.96%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 24 (10.57%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 63 (27.75%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 7 (3.08%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 14 5 4 16 31 7 4 7 1 2 1 5 1 2 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 8 4 2 1 5 2 1 0 10 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 12 0 0 5 5 1 1 3 1 2 1 1 1 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 3 1 0 1 3 1 1 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 90 65 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 65 34 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 98 92 19
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFFIMLTSWLTLSLIIQPKLLSFITTNPPSNKTPSAPKTTPWSWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 6 (10.91%)
Threonine (Thr, T)
n = 8 (14.55%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 7 (12.73%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 4 (7.27%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 0 1 3 1 2 0 2 0 0 0 0 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 0 0 0 0 0 0 3 3 4 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 2 3 1 0 0 0 0 0 1 0 0 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 19 21 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 25 10 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 22 18 11
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 49 (9.5%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 37 (7.17%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.17%)
Leucine (Leu, L)
n = 64 (12.4%)
Isoleucine (Ile, I)
n = 39 (7.56%)
Methionine (Met, M)
n = 22 (4.26%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 30 17 7 17 28 8 2 8 1 4 14 13 6 8 35
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 6 23 18 2 5 14 15 13 3 11 15 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 14 0 2 12 10 0 1 3 4 13 1 2 2 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 9 1 0 15 8 1 1 1 5 1 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
158 126 127 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 140 94 205
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
43 236 178 60
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 22 (9.69%)
Threonine (Thr, T)
n = 13 (5.73%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 32 (14.1%)
Isoleucine (Ile, I)
n = 15 (6.61%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 8 (3.52%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 13 (5.73%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 10 7 4 6 16 2 3 6 1 1 9 5 1 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 4 11 2 0 1 3 3 1 2 3 7 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 4 0 0 8 9 1 0 4 0 8 2 1 0 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 10 3 2 11 5 0 2 3 1 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 61 53 47
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 60 61 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 107 82 24
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 6 (2.31%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 11 5 4 10 12 6 1 7 1 4 4 8 1 2 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 1 15 7 0 3 8 4 3 3 6 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 5 1 4 3 6 0 2 4 2 9 0 0 2 0 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 1 0 6 4 0 1 1 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 74 54 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 69 54 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 125 84 37
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 33 (8.68%)
Serine (Ser, S)
n = 23 (6.05%)
Threonine (Thr, T)
n = 23 (6.05%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 20 (5.26%)
Leucine (Leu, L)
n = 66 (17.37%)
Isoleucine (Ile, I)
n = 30 (7.89%)
Methionine (Met, M)
n = 7 (1.84%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 7 (1.84%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 22 (5.79%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 11 (2.89%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 23 3 1 22 32 6 5 7 1 1 10 9 0 7 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 4 3 19 11 0 0 8 12 4 4 10 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 13 1 1 6 15 0 0 1 0 12 1 0 5 17 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 2 1 6 11 0 1 2 5 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
91 113 94 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 102 80 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 176 149 37
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 31 (9.54%)
Serine (Ser, S)
n = 26 (8.0%)
Threonine (Thr, T)
n = 18 (5.54%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 14 (4.31%)
Leucine (Leu, L)
n = 66 (20.31%)
Isoleucine (Ile, I)
n = 24 (7.38%)
Methionine (Met, M)
n = 12 (3.69%)
Proline (Pro, P)
n = 26 (8.0%)
Phenylalanine (Phe, F)
n = 17 (5.23%)
Tyrosine (Tyr, Y)
n = 16 (4.92%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 12 (3.69%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 18 7 8 14 32 7 5 4 2 1 5 6 2 4 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 2 4 17 10 0 0 5 8 1 1 16 7 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 6 0 2 10 7 0 1 6 8 8 2 0 1 11 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 8 0 4 4 3 1 3 2 2 1 0 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 103 81 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 94 58 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
34 142 108 42
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 34 (9.86%)
Serine (Ser, S)
n = 30 (8.7%)
Threonine (Thr, T)
n = 38 (11.01%)
Cysteine (Cys, C)
n = 5 (1.45%)
Valine (Val, V)
n = 12 (3.48%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 29 (8.41%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 13 (3.77%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 8 (2.32%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 16 15 4 22 21 8 8 9 1 0 8 3 1 2 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 4 6 15 13 0 0 5 5 2 2 6 12 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 10 1 2 11 8 1 1 7 1 6 2 3 0 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 0 0 1 11 2 0 0 4 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 99 116 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 116 55 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 154 131 37
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 34 (9.86%)
Serine (Ser, S)
n = 30 (8.7%)
Threonine (Thr, T)
n = 38 (11.01%)
Cysteine (Cys, C)
n = 5 (1.45%)
Valine (Val, V)
n = 12 (3.48%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 29 (8.41%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 22 (6.38%)
Phenylalanine (Phe, F)
n = 13 (3.77%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 8 (2.32%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 16 15 4 22 21 8 8 9 1 0 8 3 1 2 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 4 6 15 13 0 0 5 5 2 2 6 12 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 10 1 2 11 8 1 1 7 1 6 2 3 0 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 4 0 0 1 11 2 0 0 4 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 99 116 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 116 55 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 154 131 37
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 39 (8.52%)
Serine (Ser, S)
n = 42 (9.17%)
Threonine (Thr, T)
n = 40 (8.73%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 96 (20.96%)
Isoleucine (Ile, I)
n = 46 (10.04%)
Methionine (Met, M)
n = 26 (5.68%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 10 (2.18%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 13 (2.84%)
Histidine (His, H)
n = 15 (3.28%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 38 18 6 34 46 3 6 11 2 0 5 3 2 1 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 4 2 25 10 2 1 10 4 2 2 14 11 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 13 2 5 16 11 1 0 9 2 11 0 1 1 15 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 2 0 3 9 1 0 1 9 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 155 147 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 139 79 188
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 228 170 34
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 10 (10.2%)
Serine (Ser, S)
n = 11 (11.22%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 20 (20.41%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 4 (4.08%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 7 (7.14%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 4 1 4 13 1 1 2 0 0 2 1 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 2 5 3 0 0 3 1 0 0 2 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 4 0 0 7 0 0 1 3 2 1 0 0 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 1 1 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
20 34 24 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 51 36 9
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 34 (5.62%)
Alanine (Ala, A)
n = 50 (8.26%)
Serine (Ser, S)
n = 56 (9.26%)
Threonine (Thr, T)
n = 61 (10.08%)
Cysteine (Cys, C)
n = 7 (1.16%)
Valine (Val, V)
n = 19 (3.14%)
Leucine (Leu, L)
n = 105 (17.36%)
Isoleucine (Ile, I)
n = 54 (8.93%)
Methionine (Met, M)
n = 26 (4.3%)
Proline (Pro, P)
n = 31 (5.12%)
Phenylalanine (Phe, F)
n = 33 (5.45%)
Tyrosine (Tyr, Y)
n = 15 (2.48%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 24 (3.97%)
Glutamine (Gln, Q)
n = 18 (2.98%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 44 22 5 32 56 6 5 17 1 3 7 9 0 7 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 4 9 27 12 2 1 13 14 6 6 13 12 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
36 20 1 3 27 13 2 1 10 3 12 0 1 7 17 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 11 0 0 9 19 1 0 2 6 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
123 168 197 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 187 109 237
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 289 229 64
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (16.86%)
Alanine (Ala, A)
n = 13 (7.56%)
Serine (Ser, S)
n = 13 (7.56%)
Threonine (Thr, T)
n = 3 (1.74%)
Cysteine (Cys, C)
n = 3 (1.74%)
Valine (Val, V)
n = 34 (19.77%)
Leucine (Leu, L)
n = 31 (18.02%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 5 (2.91%)
Proline (Pro, P)
n = 5 (2.91%)
Phenylalanine (Phe, F)
n = 9 (5.23%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 5 (2.91%)
Aspartic acid (Asp, D)
n = 5 (2.91%)
Glutamic acid (Glu, E)
n = 3 (1.74%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 1 2 1 0 6 5 0 0 15 0 1 18 8 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 3 0 6 2 1 4 7 0 1 21 2 1 0 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 2 5 1 1 4 2 0 6 1 5 17 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 2 3 2 0 0 1 1 1 1 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
84 18 13 58
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 32 17 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
87 11 12 63
Total protein-coding genes (size: 11395 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 221 (5.82%)
Alanine (Ala, A)
n = 325 (8.56%)
Serine (Ser, S)
n = 297 (7.82%)
Threonine (Thr, T)
n = 297 (7.82%)
Cysteine (Cys, C)
n = 35 (0.92%)
Valine (Val, V)
n = 193 (5.08%)
Leucine (Leu, L)
n = 669 (17.62%)
Isoleucine (Ile, I)
n = 286 (7.53%)
Methionine (Met, M)
n = 148 (3.9%)
Proline (Pro, P)
n = 223 (5.87%)
Phenylalanine (Phe, F)
n = 212 (5.58%)
Tyrosine (Tyr, Y)
n = 114 (3.0%)
Tryptophan (Trp, W)
n = 105 (2.77%)
Aspartic acid (Asp, D)
n = 67 (1.77%)
Glutamic acid (Glu, E)
n = 87 (2.29%)
Asparagine (Asn, N)
n = 128 (3.37%)
Glutamine (Gln, Q)
n = 93 (2.45%)
Histidine (His, H)
n = 103 (2.71%)
Lysine (Lys, K)
n = 87 (2.29%)
Arginine (Arg, R)
n = 71 (1.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
69 217 106 48 185 298 66 45 81 12 32 66 63 32 46 166
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
42 9 26 45 175 91 13 19 76 70 56 28 95 92 8 34
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
150 104 9 27 112 87 10 10 51 30 84 15 27 22 106 14
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
89 64 23 6 61 78 9 8 17 41 5 2 1 6 1 90
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
892 1087 1010 781
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
496 1080 686 1508
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
329 1676 1318 447

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.