Viewing data for Crocodylus acutus


Scientific name Crocodylus acutus
Common name American crocodile
Maximum lifespan 32.90 years (Crocodylus acutus@AnAge)

Total mtDNA (size: 16883 bases) GC AT G C A T
Base content (bases) 7179 9704 4713 2466 4239 5465
Base content per 1 kb (bases) 425 575 279 146 251 324
Base content (%) 42.5% 57.5%
Total protein-coding genes (size: 11391 bases) GC AT G C A T
Base content (bases) 4941 6450 3411 1530 2920 3530
Base content per 1 kb (bases) 434 566 299 134 256 310
Base content (%) 43.4% 56.6%
D-loop (size: 1155 bases) GC AT G C A T
Base content (bases) 351 804 214 137 348 456
Base content per 1 kb (bases) 304 696 185 119 301 395
Base content (%) 30.4% 69.6%
Total tRNA-coding genes (size: 1545 bases) GC AT G C A T
Base content (bases) 656 889 380 276 397 492
Base content per 1 kb (bases) 425 575 246 179 257 318
Base content (%) 42.5% 57.5%
Total rRNA-coding genes (size: 2578 bases) GC AT G C A T
Base content (bases) 1148 1430 641 507 535 895
Base content per 1 kb (bases) 445 555 249 197 208 347
Base content (%) 44.5% 55.5%
12S rRNA gene (size: 984 bases) GC AT G C A T
Base content (bases) 465 519 258 207 197 322
Base content per 1 kb (bases) 473 527 262 210 200 327
Base content (%) 47.3% 52.7%
16S rRNA gene (size: 1594 bases) GC AT G C A T
Base content (bases) 683 911 383 300 338 573
Base content per 1 kb (bases) 428 572 240 188 212 359
Base content (%) 42.8% 57.2%

ATP6 (size: 696 bases) GC AT G C A T
Base content (bases) 298 398 216 82 175 223
Base content per 1 kb (bases) 428 572 310 118 251 320
Base content (%) 42.8% 57.2%
ATP8 (size: 162 bases) GC AT G C A T
Base content (bases) 55 107 42 13 40 67
Base content per 1 kb (bases) 340 660 259 80 247 414
Base content (%) 34.0% 66.0%
COX1 (size: 1557 bases) GC AT G C A T
Base content (bases) 662 895 411 251 440 455
Base content per 1 kb (bases) 425 575 264 161 283 292
Base content (%) 42.5% 57.5%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 286 398 191 95 169 229
Base content per 1 kb (bases) 418 582 279 139 247 335
Base content (%) 41.8% 58.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 356 428 227 129 213 215
Base content per 1 kb (bases) 454 546 290 165 272 274
Base content (%) 45.4% 54.6%
CYTB (size: 1165 bases) GC AT G C A T
Base content (bases) 513 652 357 156 299 353
Base content per 1 kb (bases) 440 560 306 134 257 303
Base content (%) 44.0% 56.0%
ND1 (size: 963 bases) GC AT G C A T
Base content (bases) 423 540 279 144 265 275
Base content per 1 kb (bases) 439 561 290 150 275 286
Base content (%) 43.9% 56.1%
ND2 (size: 1056 bases) GC AT G C A T
Base content (bases) 467 589 342 125 266 323
Base content per 1 kb (bases) 442 558 324 118 252 306
Base content (%) 44.2% 55.8%
ND3 (size: 348 bases) GC AT G C A T
Base content (bases) 156 192 101 55 91 101
Base content per 1 kb (bases) 448 552 290 158 261 290
Base content (%) 44.8% 55.2%
ND4 (size: 1374 bases) GC AT G C A T
Base content (bases) 590 784 413 177 352 432
Base content per 1 kb (bases) 429 571 301 129 256 314
Base content (%) 42.9% 57.1%
ND4L (size: 294 bases) GC AT G C A T
Base content (bases) 130 164 95 35 87 77
Base content per 1 kb (bases) 442 558 323 119 296 262
Base content (%) 44.2% 55.8%
ND5 (size: 1860 bases) GC AT G C A T
Base content (bases) 811 1049 582 229 455 594
Base content per 1 kb (bases) 436 564 313 123 245 319
Base content (%) 43.6% 56.4%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 232 296 180 52 82 214
Base content per 1 kb (bases) 439 561 341 98 155 405
Base content (%) 43.9% 56.1%

ATP6 (size: 696 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.03%)
Alanine (Ala, A)
n = 18 (7.79%)
Serine (Ser, S)
n = 12 (5.19%)
Threonine (Thr, T)
n = 27 (11.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.9%)
Leucine (Leu, L)
n = 62 (26.84%)
Isoleucine (Ile, I)
n = 18 (7.79%)
Methionine (Met, M)
n = 11 (4.76%)
Proline (Pro, P)
n = 15 (6.49%)
Phenylalanine (Phe, F)
n = 5 (2.16%)
Tyrosine (Tyr, Y)
n = 4 (1.73%)
Tryptophan (Trp, W)
n = 4 (1.73%)
Aspartic acid (Asp, D)
n = 2 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.73%)
Asparagine (Asn, N)
n = 12 (5.19%)
Glutamine (Gln, Q)
n = 7 (3.03%)
Histidine (His, H)
n = 4 (1.73%)
Lysine (Lys, K)
n = 6 (2.6%)
Arginine (Arg, R)
n = 4 (1.73%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 12 8 5 11 24 11 8 6 1 0 0 6 3 4 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 9 7 1 0 3 3 1 3 1 10 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 14 0 3 2 5 1 0 1 3 1 0 3 2 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 1 0 2 6 0 0 1 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 81 75 36
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 71 40 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 64 108 34
ATP8 (size: 162 bases)
Amino acid sequence: MPQLNPEPWLMILSTTWLVFVITLQPKIASMKFMNNPSNPNQKTTKTWPWPQI*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.89%)
Serine (Ser, S)
n = 3 (5.66%)
Threonine (Thr, T)
n = 6 (11.32%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (3.77%)
Leucine (Leu, L)
n = 5 (9.43%)
Isoleucine (Ile, I)
n = 4 (7.55%)
Methionine (Met, M)
n = 4 (7.55%)
Proline (Pro, P)
n = 8 (15.09%)
Phenylalanine (Phe, F)
n = 2 (3.77%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 4 (7.55%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.89%)
Asparagine (Asn, N)
n = 5 (9.43%)
Glutamine (Gln, Q)
n = 4 (7.55%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (7.55%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 2 0 0 1 0 4 4 0 1 0 1 0 0 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 0 0 0 0 0 0 0 1 1 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 0 1 1 0 0 0 1 0 0 2 0 1 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 0 4 0 0 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 13 24 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 17 15 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 12 28 10
COX1 (size: 1557 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 43 (8.3%)
Alanine (Ala, A)
n = 36 (6.95%)
Serine (Ser, S)
n = 35 (6.76%)
Threonine (Thr, T)
n = 39 (7.53%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 39 (7.53%)
Leucine (Leu, L)
n = 54 (10.42%)
Isoleucine (Ile, I)
n = 41 (7.92%)
Methionine (Met, M)
n = 31 (5.98%)
Proline (Pro, P)
n = 31 (5.98%)
Phenylalanine (Phe, F)
n = 47 (9.07%)
Tyrosine (Tyr, Y)
n = 17 (3.28%)
Tryptophan (Trp, W)
n = 17 (3.28%)
Aspartic acid (Asp, D)
n = 14 (2.7%)
Glutamic acid (Glu, E)
n = 9 (1.74%)
Asparagine (Asn, N)
n = 18 (3.47%)
Glutamine (Gln, Q)
n = 12 (2.32%)
Histidine (His, H)
n = 16 (3.09%)
Lysine (Lys, K)
n = 10 (1.93%)
Arginine (Arg, R)
n = 8 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 19 24 10 10 20 3 7 11 1 9 7 20 3 19 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 0 7 16 13 0 5 8 21 9 3 7 20 1 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 19 1 2 8 15 2 0 8 7 10 1 4 5 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 8 1 6 8 10 0 1 1 6 0 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
141 110 147 121
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 133 97 212
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 168 211 107
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 10 (4.41%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 21 (9.25%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 31 (13.66%)
Isoleucine (Ile, I)
n = 15 (6.61%)
Methionine (Met, M)
n = 14 (6.17%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 10 (4.41%)
Histidine (His, H)
n = 10 (4.41%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 9 10 2 5 17 2 5 7 3 3 4 6 1 5 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 2 2 5 1 1 1 3 3 3 3 7 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 13 1 2 4 6 0 1 3 6 3 1 0 2 7 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 11 0 2 8 3 0 0 3 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 65 66 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 57 63 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 69 100 42
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (6.92%)
Alanine (Ala, A)
n = 20 (7.69%)
Serine (Ser, S)
n = 16 (6.15%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 34 (13.08%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 13 (5.0%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 1 (0.38%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 9 10 4 4 13 5 8 6 0 5 5 4 1 6 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 4 11 3 2 3 7 5 3 2 0 10 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 0 0 2 6 1 0 7 7 4 3 0 2 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 1 1 3 1 0 0 0 5 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 67 65 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 52 100
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 95 98 48
CYTB (size: 1165 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.46%)
Alanine (Ala, A)
n = 28 (7.24%)
Serine (Ser, S)
n = 26 (6.72%)
Threonine (Thr, T)
n = 27 (6.98%)
Cysteine (Cys, C)
n = 1 (0.26%)
Valine (Val, V)
n = 16 (4.13%)
Leucine (Leu, L)
n = 67 (17.31%)
Isoleucine (Ile, I)
n = 28 (7.24%)
Methionine (Met, M)
n = 18 (4.65%)
Proline (Pro, P)
n = 25 (6.46%)
Phenylalanine (Phe, F)
n = 27 (6.98%)
Tyrosine (Tyr, Y)
n = 16 (4.13%)
Tryptophan (Trp, W)
n = 12 (3.1%)
Aspartic acid (Asp, D)
n = 11 (2.84%)
Glutamic acid (Glu, E)
n = 6 (1.55%)
Asparagine (Asn, N)
n = 15 (3.88%)
Glutamine (Gln, Q)
n = 8 (2.07%)
Histidine (His, H)
n = 12 (3.1%)
Lysine (Lys, K)
n = 9 (2.33%)
Arginine (Arg, R)
n = 11 (2.84%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 20 15 7 10 31 4 15 7 1 2 4 9 1 7 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 4 13 11 0 1 3 20 1 2 5 16 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 1 4 7 11 1 0 3 2 14 1 0 2 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 0 3 8 8 1 0 3 6 2 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 108 100 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 103 77 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 146 176 48
ND1 (size: 963 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (5.0%)
Alanine (Ala, A)
n = 29 (9.06%)
Serine (Ser, S)
n = 25 (7.81%)
Threonine (Thr, T)
n = 27 (8.44%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 16 (5.0%)
Leucine (Leu, L)
n = 65 (20.31%)
Isoleucine (Ile, I)
n = 26 (8.13%)
Methionine (Met, M)
n = 12 (3.75%)
Proline (Pro, P)
n = 18 (5.63%)
Phenylalanine (Phe, F)
n = 19 (5.94%)
Tyrosine (Tyr, Y)
n = 11 (3.44%)
Tryptophan (Trp, W)
n = 8 (2.5%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 10 (3.13%)
Asparagine (Asn, N)
n = 11 (3.44%)
Glutamine (Gln, Q)
n = 6 (1.88%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.19%)
Arginine (Arg, R)
n = 7 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 16 11 6 4 27 11 14 5 1 4 6 5 1 8 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 12 13 0 3 7 4 2 2 7 8 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 13 3 4 3 11 2 2 3 4 7 0 3 2 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 7 3 1 2 6 1 1 1 3 2 0 1 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 82 89 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 94 51 138
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
32 103 135 51
ND2 (size: 1056 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.42%)
Alanine (Ala, A)
n = 32 (9.12%)
Serine (Ser, S)
n = 29 (8.26%)
Threonine (Thr, T)
n = 45 (12.82%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (4.27%)
Leucine (Leu, L)
n = 65 (18.52%)
Isoleucine (Ile, I)
n = 33 (9.4%)
Methionine (Met, M)
n = 14 (3.99%)
Proline (Pro, P)
n = 18 (5.13%)
Phenylalanine (Phe, F)
n = 15 (4.27%)
Tyrosine (Tyr, Y)
n = 9 (2.56%)
Tryptophan (Trp, W)
n = 10 (2.85%)
Aspartic acid (Asp, D)
n = 1 (0.28%)
Glutamic acid (Glu, E)
n = 7 (1.99%)
Asparagine (Asn, N)
n = 11 (3.13%)
Glutamine (Gln, Q)
n = 15 (4.27%)
Histidine (His, H)
n = 3 (0.85%)
Lysine (Lys, K)
n = 12 (3.42%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 13 9 10 13 29 5 8 13 2 3 3 4 5 2 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 2 20 10 0 0 5 4 3 0 5 12 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 21 1 6 13 3 3 0 4 4 5 0 0 3 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 2 0 1 12 0 0 1 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 98 119 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 120 59 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 124 145 56
ND3 (size: 1056 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.42%)
Alanine (Ala, A)
n = 32 (9.12%)
Serine (Ser, S)
n = 29 (8.26%)
Threonine (Thr, T)
n = 45 (12.82%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 15 (4.27%)
Leucine (Leu, L)
n = 65 (18.52%)
Isoleucine (Ile, I)
n = 33 (9.4%)
Methionine (Met, M)
n = 14 (3.99%)
Proline (Pro, P)
n = 18 (5.13%)
Phenylalanine (Phe, F)
n = 15 (4.27%)
Tyrosine (Tyr, Y)
n = 9 (2.56%)
Tryptophan (Trp, W)
n = 10 (2.85%)
Aspartic acid (Asp, D)
n = 1 (0.28%)
Glutamic acid (Glu, E)
n = 7 (1.99%)
Asparagine (Asn, N)
n = 11 (3.13%)
Glutamine (Gln, Q)
n = 15 (4.27%)
Histidine (His, H)
n = 3 (0.85%)
Lysine (Lys, K)
n = 12 (3.42%)
Arginine (Arg, R)
n = 5 (1.42%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 13 9 10 13 29 5 8 13 2 3 3 4 5 2 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 2 20 10 0 0 5 4 3 0 5 12 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 21 1 6 13 3 3 0 4 4 5 0 0 3 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 5 2 0 1 12 0 0 1 4 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 98 119 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 120 59 142
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 124 145 56
ND4 (size: 1374 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (4.81%)
Alanine (Ala, A)
n = 30 (6.56%)
Serine (Ser, S)
n = 40 (8.75%)
Threonine (Thr, T)
n = 55 (12.04%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 16 (3.5%)
Leucine (Leu, L)
n = 91 (19.91%)
Isoleucine (Ile, I)
n = 35 (7.66%)
Methionine (Met, M)
n = 34 (7.44%)
Proline (Pro, P)
n = 22 (4.81%)
Phenylalanine (Phe, F)
n = 14 (3.06%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 11 (2.41%)
Aspartic acid (Asp, D)
n = 7 (1.53%)
Glutamic acid (Glu, E)
n = 7 (1.53%)
Asparagine (Asn, N)
n = 10 (2.19%)
Glutamine (Gln, Q)
n = 18 (3.94%)
Histidine (His, H)
n = 10 (2.19%)
Lysine (Lys, K)
n = 8 (1.75%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 13 27 11 10 46 6 16 17 1 3 2 8 3 7 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 5 1 17 11 1 2 8 10 2 1 9 10 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 19 7 3 13 12 2 3 7 4 9 2 2 3 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 2 0 7 8 0 1 0 7 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 132 152 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 137 74 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 144 206 70
ND4L (size: 294 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.12%)
Alanine (Ala, A)
n = 8 (8.25%)
Serine (Ser, S)
n = 10 (10.31%)
Threonine (Thr, T)
n = 11 (11.34%)
Cysteine (Cys, C)
n = 3 (3.09%)
Valine (Val, V)
n = 2 (2.06%)
Leucine (Leu, L)
n = 23 (23.71%)
Isoleucine (Ile, I)
n = 6 (6.19%)
Methionine (Met, M)
n = 4 (4.12%)
Proline (Pro, P)
n = 2 (2.06%)
Phenylalanine (Phe, F)
n = 7 (7.22%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.03%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (2.06%)
Asparagine (Asn, N)
n = 7 (7.22%)
Glutamine (Gln, Q)
n = 1 (1.03%)
Histidine (His, H)
n = 3 (3.09%)
Lysine (Lys, K)
n = 1 (1.03%)
Arginine (Arg, R)
n = 2 (2.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 2 1 5 11 2 3 1 0 0 1 0 1 2 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 2 5 1 0 0 3 1 0 1 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 5 0 3 1 4 2 0 0 0 0 1 1 2 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 0 1 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
16 27 29 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 31 15 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 37 33 19
ND5 (size: 1860 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.04%)
Alanine (Ala, A)
n = 51 (8.24%)
Serine (Ser, S)
n = 60 (9.69%)
Threonine (Thr, T)
n = 66 (10.66%)
Cysteine (Cys, C)
n = 4 (0.65%)
Valine (Val, V)
n = 20 (3.23%)
Leucine (Leu, L)
n = 100 (16.16%)
Isoleucine (Ile, I)
n = 60 (9.69%)
Methionine (Met, M)
n = 35 (5.65%)
Proline (Pro, P)
n = 31 (5.01%)
Phenylalanine (Phe, F)
n = 28 (4.52%)
Tyrosine (Tyr, Y)
n = 18 (2.91%)
Tryptophan (Trp, W)
n = 7 (1.13%)
Aspartic acid (Asp, D)
n = 13 (2.1%)
Glutamic acid (Glu, E)
n = 15 (2.42%)
Asparagine (Asn, N)
n = 21 (3.39%)
Glutamine (Gln, Q)
n = 20 (3.23%)
Histidine (His, H)
n = 12 (1.94%)
Lysine (Lys, K)
n = 24 (3.88%)
Arginine (Arg, R)
n = 9 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 35 25 11 16 48 10 13 19 1 4 4 10 2 10 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 1 3 6 26 18 1 2 8 10 5 3 10 18 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
29 22 2 4 17 22 1 2 14 6 12 3 2 4 17 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 11 4 3 10 21 3 0 3 6 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
124 157 222 117
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
61 192 124 243
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 233 248 95
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (16.0%)
Alanine (Ala, A)
n = 13 (7.43%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 5 (2.86%)
Cysteine (Cys, C)
n = 7 (4.0%)
Valine (Val, V)
n = 26 (14.86%)
Leucine (Leu, L)
n = 26 (14.86%)
Isoleucine (Ile, I)
n = 6 (3.43%)
Methionine (Met, M)
n = 7 (4.0%)
Proline (Pro, P)
n = 1 (0.57%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 7 (4.0%)
Tryptophan (Trp, W)
n = 5 (2.86%)
Aspartic acid (Asp, D)
n = 5 (2.86%)
Glutamic acid (Glu, E)
n = 4 (2.29%)
Asparagine (Asn, N)
n = 1 (0.57%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.14%)
Lysine (Lys, K)
n = 2 (1.14%)
Arginine (Arg, R)
n = 4 (2.29%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 0 3 4 1 3 1 9 0 0 10 1 4 11 12 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 7 0 7 1 3 2 7 4 4 13 0 0 0 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 1 3 0 1 1 6 1 7 0 4 8 1 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 4 1 1 1 2 0 2 0 0 1 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 16 29 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 24 21 79
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 12 32 80
Total protein-coding genes (size: 11471 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 213 (5.57%)
Alanine (Ala, A)
n = 289 (7.56%)
Serine (Ser, S)
n = 290 (7.59%)
Threonine (Thr, T)
n = 361 (9.45%)
Cysteine (Cys, C)
n = 28 (0.73%)
Valine (Val, V)
n = 194 (5.08%)
Leucine (Leu, L)
n = 648 (16.95%)
Isoleucine (Ile, I)
n = 296 (7.74%)
Methionine (Met, M)
n = 203 (5.31%)
Proline (Pro, P)
n = 204 (5.34%)
Phenylalanine (Phe, F)
n = 217 (5.68%)
Tyrosine (Tyr, Y)
n = 117 (3.06%)
Tryptophan (Trp, W)
n = 100 (2.62%)
Aspartic acid (Asp, D)
n = 73 (1.91%)
Glutamic acid (Glu, E)
n = 91 (2.38%)
Asparagine (Asn, N)
n = 127 (3.32%)
Glutamine (Gln, Q)
n = 109 (2.85%)
Histidine (His, H)
n = 92 (2.41%)
Lysine (Lys, K)
n = 89 (2.33%)
Arginine (Arg, R)
n = 71 (1.86%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
139 157 151 75 91 284 62 113 97 12 44 39 79 32 86 131
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
52 14 14 42 139 100 8 25 58 87 43 21 50 121 12 56
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
134 154 17 36 72 98 16 14 54 52 65 18 23 29 98 19
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
73 71 20 20 53 83 6 5 16 45 5 0 2 8 1 82
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
860 988 1146 829
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
482 1076 707 1558
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
329 1244 1573 677

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.