Viewing data for Latimeria chalumnae


Scientific name Latimeria chalumnae
Common name Coelacanth
Maximum lifespan 48.00 years (Latimeria chalumnae@AnAge)

Total mtDNA (size: 16407 bases) GC AT G C A T
Base content (bases) 6836 9571 4389 2447 3920 5651
Base content per 1 kb (bases) 417 583 268 149 239 344
Base content (%) 41.7% 58.3%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 4736 6642 3186 1550 2776 3866
Base content per 1 kb (bases) 416 584 280 136 244 340
Base content (%) 41.6% 58.4%
D-loop (size: 781 bases) GC AT G C A T
Base content (bases) 272 509 145 127 246 263
Base content per 1 kb (bases) 348 652 186 163 315 337
Base content (%) 34.8% 65.2%
Total tRNA-coding genes (size: 1547 bases) GC AT G C A T
Base content (bases) 660 887 386 274 361 526
Base content per 1 kb (bases) 427 573 250 177 233 340
Base content (%) 42.7% 57.3%
Total rRNA-coding genes (size: 2648 bases) GC AT G C A T
Base content (bases) 1152 1496 661 491 525 971
Base content per 1 kb (bases) 435 565 250 185 198 367
Base content (%) 43.5% 56.5%
12S rRNA gene (size: 983 bases) GC AT G C A T
Base content (bases) 454 529 265 189 177 352
Base content per 1 kb (bases) 462 538 270 192 180 358
Base content (%) 46.2% 53.8%
16S rRNA gene (size: 1665 bases) GC AT G C A T
Base content (bases) 698 967 396 302 348 619
Base content per 1 kb (bases) 419 581 238 181 209 372
Base content (%) 41.9% 58.1%

ATP6 (size: 661 bases) GC AT G C A T
Base content (bases) 280 381 197 83 166 215
Base content per 1 kb (bases) 424 576 298 126 251 325
Base content (%) 42.4% 57.6%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 72 96 59 13 37 59
Base content per 1 kb (bases) 429 571 351 77 220 351
Base content (%) 42.9% 57.1%
COX1 (size: 1548 bases) GC AT G C A T
Base content (bases) 666 882 396 270 410 472
Base content per 1 kb (bases) 430 570 256 174 265 305
Base content (%) 43.0% 57.0%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 285 406 176 109 172 234
Base content per 1 kb (bases) 412 588 255 158 249 339
Base content (%) 41.2% 58.8%
COX3 (size: 786 bases) GC AT G C A T
Base content (bases) 343 443 215 128 208 235
Base content per 1 kb (bases) 436 564 274 163 265 299
Base content (%) 43.6% 56.4%
CYTB (size: 1142 bases) GC AT G C A T
Base content (bases) 499 643 337 162 286 357
Base content per 1 kb (bases) 437 563 295 142 250 313
Base content (%) 43.7% 56.3%
ND1 (size: 972 bases) GC AT G C A T
Base content (bases) 404 568 275 129 245 323
Base content per 1 kb (bases) 416 584 283 133 252 332
Base content (%) 41.6% 58.4%
ND2 (size: 1047 bases) GC AT G C A T
Base content (bases) 414 633 295 119 244 389
Base content per 1 kb (bases) 395 605 282 114 233 372
Base content (%) 39.5% 60.5%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 152 197 101 51 92 105
Base content per 1 kb (bases) 436 564 289 146 264 301
Base content (%) 43.6% 56.4%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 554 827 382 172 351 476
Base content per 1 kb (bases) 401 599 277 125 254 345
Base content (%) 40.1% 59.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 135 162 91 44 68 94
Base content per 1 kb (bases) 455 545 306 148 229 316
Base content (%) 45.5% 54.5%
ND5 (size: 1836 bases) GC AT G C A T
Base content (bases) 724 1112 509 215 439 673
Base content per 1 kb (bases) 394 606 277 117 239 367
Base content (%) 39.4% 60.6%
ND6 (size: 520 bases) GC AT G C A T
Base content (bases) 214 306 156 58 63 243
Base content per 1 kb (bases) 412 588 300 112 121 467
Base content (%) 41.2% 58.8%

ATP6 (size: 661 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (5.02%)
Alanine (Ala, A)
n = 17 (7.76%)
Serine (Ser, S)
n = 6 (2.74%)
Threonine (Thr, T)
n = 24 (10.96%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 11 (5.02%)
Leucine (Leu, L)
n = 54 (24.66%)
Isoleucine (Ile, I)
n = 14 (6.39%)
Methionine (Met, M)
n = 11 (5.02%)
Proline (Pro, P)
n = 16 (7.31%)
Phenylalanine (Phe, F)
n = 12 (5.48%)
Tyrosine (Tyr, Y)
n = 3 (1.37%)
Tryptophan (Trp, W)
n = 5 (2.28%)
Aspartic acid (Asp, D)
n = 1 (0.46%)
Glutamic acid (Glu, E)
n = 4 (1.83%)
Asparagine (Asn, N)
n = 12 (5.48%)
Glutamine (Gln, Q)
n = 9 (4.11%)
Histidine (His, H)
n = 3 (1.37%)
Lysine (Lys, K)
n = 1 (0.46%)
Arginine (Arg, R)
n = 6 (2.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 7 8 5 8 25 6 10 9 0 1 2 7 1 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 7 6 1 0 2 9 0 1 2 12 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 16 0 0 0 2 0 0 4 2 1 1 0 4 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 1 0 1 2 3 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 78 66 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 59 33 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 60 116 31
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPSPWLLILLFSWLIFLTMLPSKTQLHTFPNMPSTQNMCKQEPEPWTWPWA*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 5 (9.09%)
Cysteine (Cys, C)
n = 1 (1.82%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 9 (16.36%)
Isoleucine (Ile, I)
n = 2 (3.64%)
Methionine (Met, M)
n = 4 (7.27%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 3 (5.45%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (3.64%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 4 (7.27%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 2 2 0 2 4 1 2 4 0 0 0 0 0 0 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 0 1 0 0 0 0 0 0 0 3 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 0 1 2 1 0 0 0 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 0 1 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 21 16 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 19 13 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 19 30 3
COX1 (size: 1548 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.32%)
Alanine (Ala, A)
n = 42 (8.16%)
Serine (Ser, S)
n = 26 (5.05%)
Threonine (Thr, T)
n = 41 (7.96%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.77%)
Leucine (Leu, L)
n = 63 (12.23%)
Isoleucine (Ile, I)
n = 39 (7.57%)
Methionine (Met, M)
n = 30 (5.83%)
Proline (Pro, P)
n = 29 (5.63%)
Phenylalanine (Phe, F)
n = 37 (7.18%)
Tyrosine (Tyr, Y)
n = 18 (3.5%)
Tryptophan (Trp, W)
n = 17 (3.3%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 20 (3.88%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 9 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 22 26 4 9 34 8 8 5 2 3 3 26 8 17 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 8 13 19 2 6 10 26 6 6 5 16 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 29 0 5 3 13 1 0 4 9 9 2 0 3 12 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 0 5 10 7 1 3 0 6 0 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
155 120 137 104
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
79 134 94 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 142 241 97
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.49%)
Alanine (Ala, A)
n = 16 (6.99%)
Serine (Ser, S)
n = 16 (6.99%)
Threonine (Thr, T)
n = 10 (4.37%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 14 (6.11%)
Leucine (Leu, L)
n = 32 (13.97%)
Isoleucine (Ile, I)
n = 20 (8.73%)
Methionine (Met, M)
n = 14 (6.11%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 17 (7.42%)
Asparagine (Asn, N)
n = 4 (1.75%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 9 (3.93%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 8 11 2 4 18 2 5 7 1 3 4 6 1 4 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 2 4 10 0 0 2 5 1 1 4 8 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 8 1 2 1 7 2 0 4 6 4 0 1 0 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 14 3 4 9 4 0 0 1 5 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 63 56 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 52 65 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 61 113 40
COX3 (size: 786 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.28%)
Alanine (Ala, A)
n = 22 (8.43%)
Serine (Ser, S)
n = 17 (6.51%)
Threonine (Thr, T)
n = 23 (8.81%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 16 (6.13%)
Leucine (Leu, L)
n = 33 (12.64%)
Isoleucine (Ile, I)
n = 16 (6.13%)
Methionine (Met, M)
n = 7 (2.68%)
Proline (Pro, P)
n = 12 (4.6%)
Phenylalanine (Phe, F)
n = 23 (8.81%)
Tyrosine (Tyr, Y)
n = 12 (4.6%)
Tryptophan (Trp, W)
n = 12 (4.6%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.45%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 9 (3.45%)
Histidine (His, H)
n = 15 (5.75%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 7 5 1 2 20 4 5 9 0 3 3 10 0 10 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 2 9 10 1 3 5 8 3 3 4 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 16 1 1 2 8 1 1 4 4 8 0 1 0 3 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 2 2 3 2 0 0 0 5 0 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 68 56 67
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 69 56 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 78 123 46
CYTB (size: 1142 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (6.86%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 35 (9.23%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 20 (5.28%)
Leucine (Leu, L)
n = 53 (13.98%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 7 (1.85%)
Asparagine (Asn, N)
n = 20 (5.28%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.9%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 25 5 3 10 29 4 7 8 0 4 3 11 2 3 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 2 3 10 10 0 1 4 18 3 0 5 13 3 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 17 1 3 4 11 2 1 1 6 8 0 0 1 19 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 1 3 7 7 2 1 1 6 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 94 116 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 99 79 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 144 161 51
ND1 (size: 972 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (5.88%)
Alanine (Ala, A)
n = 27 (8.36%)
Serine (Ser, S)
n = 21 (6.5%)
Threonine (Thr, T)
n = 28 (8.67%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (3.72%)
Leucine (Leu, L)
n = 61 (18.89%)
Isoleucine (Ile, I)
n = 27 (8.36%)
Methionine (Met, M)
n = 15 (4.64%)
Proline (Pro, P)
n = 24 (7.43%)
Phenylalanine (Phe, F)
n = 17 (5.26%)
Tyrosine (Tyr, Y)
n = 10 (3.1%)
Tryptophan (Trp, W)
n = 8 (2.48%)
Aspartic acid (Asp, D)
n = 3 (0.93%)
Glutamic acid (Glu, E)
n = 11 (3.41%)
Asparagine (Asn, N)
n = 13 (4.02%)
Glutamine (Gln, Q)
n = 6 (1.86%)
Histidine (His, H)
n = 5 (1.55%)
Lysine (Lys, K)
n = 8 (2.48%)
Arginine (Arg, R)
n = 8 (2.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 13 11 4 9 38 3 7 4 2 0 2 9 1 9 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 1 9 16 1 4 4 9 2 2 2 19 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 15 1 1 5 11 1 1 2 7 3 0 0 4 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 10 1 1 2 6 2 0 0 8 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 97 94 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 97 57 132
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 81 172 52
ND2 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.17%)
Alanine (Ala, A)
n = 31 (8.91%)
Serine (Ser, S)
n = 22 (6.32%)
Threonine (Thr, T)
n = 52 (14.94%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.01%)
Leucine (Leu, L)
n = 67 (19.25%)
Isoleucine (Ile, I)
n = 22 (6.32%)
Methionine (Met, M)
n = 28 (8.05%)
Proline (Pro, P)
n = 18 (5.17%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 7 (2.01%)
Tryptophan (Trp, W)
n = 10 (2.87%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 7 (2.01%)
Asparagine (Asn, N)
n = 16 (4.6%)
Glutamine (Gln, Q)
n = 10 (2.87%)
Histidine (His, H)
n = 6 (1.72%)
Lysine (Lys, K)
n = 13 (3.74%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 12 26 9 8 34 5 10 8 2 1 1 4 1 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 5 12 14 0 4 2 11 1 4 5 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 34 0 0 3 13 1 0 5 3 4 1 1 5 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 7 0 0 0 10 3 0 0 3 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 94 136 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 118 60 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 83 193 55
ND3 (size: 1047 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.17%)
Alanine (Ala, A)
n = 31 (8.91%)
Serine (Ser, S)
n = 22 (6.32%)
Threonine (Thr, T)
n = 52 (14.94%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 7 (2.01%)
Leucine (Leu, L)
n = 67 (19.25%)
Isoleucine (Ile, I)
n = 22 (6.32%)
Methionine (Met, M)
n = 28 (8.05%)
Proline (Pro, P)
n = 18 (5.17%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 7 (2.01%)
Tryptophan (Trp, W)
n = 10 (2.87%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 7 (2.01%)
Asparagine (Asn, N)
n = 16 (4.6%)
Glutamine (Gln, Q)
n = 10 (2.87%)
Histidine (His, H)
n = 6 (1.72%)
Lysine (Lys, K)
n = 13 (3.74%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 12 26 9 8 34 5 10 8 2 1 1 4 1 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 5 12 14 0 4 2 11 1 4 5 9 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 34 0 0 3 13 1 0 5 3 4 1 1 5 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 7 0 0 0 10 3 0 0 3 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 94 136 56
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 118 60 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 83 193 55
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (5.66%)
Alanine (Ala, A)
n = 31 (6.75%)
Serine (Ser, S)
n = 28 (6.1%)
Threonine (Thr, T)
n = 49 (10.68%)
Cysteine (Cys, C)
n = 4 (0.87%)
Valine (Val, V)
n = 13 (2.83%)
Leucine (Leu, L)
n = 86 (18.74%)
Isoleucine (Ile, I)
n = 37 (8.06%)
Methionine (Met, M)
n = 41 (8.93%)
Proline (Pro, P)
n = 22 (4.79%)
Phenylalanine (Phe, F)
n = 15 (3.27%)
Tyrosine (Tyr, Y)
n = 11 (2.4%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 11 (2.4%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 14 (3.05%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 23 32 10 14 42 3 16 11 0 4 2 6 1 7 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 3 7 13 11 0 5 5 15 1 1 4 16 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 31 0 2 7 14 0 0 5 3 8 4 1 5 11 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 2 0 4 11 0 0 1 10 0 0 0 0 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 127 159 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
65 125 78 192
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 130 239 69
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (7.14%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 7 (7.14%)
Threonine (Thr, T)
n = 11 (11.22%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 23 (23.47%)
Isoleucine (Ile, I)
n = 0 (0%)
Methionine (Met, M)
n = 8 (8.16%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 2 (2.04%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 3 (3.06%)
Glutamine (Gln, Q)
n = 4 (4.08%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 0 6 0 5 11 3 4 4 0 0 0 3 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 4 4 0 1 2 4 0 0 0 3 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 6 1 0 3 3 0 0 1 1 1 0 0 0 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 1 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 32 23 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 30 53 9
ND5 (size: 1836 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (4.75%)
Alanine (Ala, A)
n = 43 (7.04%)
Serine (Ser, S)
n = 36 (5.89%)
Threonine (Thr, T)
n = 70 (11.46%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 21 (3.44%)
Leucine (Leu, L)
n = 83 (13.58%)
Isoleucine (Ile, I)
n = 55 (9.0%)
Methionine (Met, M)
n = 42 (6.87%)
Proline (Pro, P)
n = 25 (4.09%)
Phenylalanine (Phe, F)
n = 37 (6.06%)
Tyrosine (Tyr, Y)
n = 15 (2.45%)
Tryptophan (Trp, W)
n = 15 (2.45%)
Aspartic acid (Asp, D)
n = 12 (1.96%)
Glutamic acid (Glu, E)
n = 11 (1.8%)
Asparagine (Asn, N)
n = 38 (6.22%)
Glutamine (Gln, Q)
n = 25 (4.09%)
Histidine (His, H)
n = 14 (2.29%)
Lysine (Lys, K)
n = 25 (4.09%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 36 31 7 10 49 7 10 24 1 5 7 8 1 18 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
11 1 5 4 16 23 0 2 6 19 2 2 5 16 2 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 37 0 2 6 14 1 4 9 6 9 0 0 8 30 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 1 5 7 24 1 1 0 8 0 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
116 146 243 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
72 161 141 238
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 202 289 94
ND6 (size: 520 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.79%)
Alanine (Ala, A)
n = 14 (8.14%)
Serine (Ser, S)
n = 15 (8.72%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 26 (15.12%)
Leucine (Leu, L)
n = 30 (17.44%)
Isoleucine (Ile, I)
n = 4 (2.33%)
Methionine (Met, M)
n = 7 (4.07%)
Proline (Pro, P)
n = 5 (2.91%)
Phenylalanine (Phe, F)
n = 15 (8.72%)
Tyrosine (Tyr, Y)
n = 14 (8.14%)
Tryptophan (Trp, W)
n = 6 (3.49%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 4 (2.33%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 4 4 1 0 1 5 0 0 17 1 2 6 15 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 7 0 5 2 5 4 2 11 3 1 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 7 2 3 1 2 0 13 1 5 19 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 3 0 0 0 2 0 1 0 0 0 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 14 16 74
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 34 22 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
52 10 24 87
Total protein-coding genes (size: 11398 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 239 (6.3%)
Alanine (Ala, A)
n = 286 (7.53%)
Serine (Ser, S)
n = 226 (5.95%)
Threonine (Thr, T)
n = 359 (9.46%)
Cysteine (Cys, C)
n = 25 (0.66%)
Valine (Val, V)
n = 184 (4.85%)
Leucine (Leu, L)
n = 622 (16.39%)
Isoleucine (Ile, I)
n = 285 (7.51%)
Methionine (Met, M)
n = 223 (5.87%)
Proline (Pro, P)
n = 206 (5.43%)
Phenylalanine (Phe, F)
n = 214 (5.64%)
Tyrosine (Tyr, Y)
n = 117 (3.08%)
Tryptophan (Trp, W)
n = 121 (3.19%)
Aspartic acid (Asp, D)
n = 71 (1.87%)
Glutamic acid (Glu, E)
n = 102 (2.69%)
Asparagine (Asn, N)
n = 147 (3.87%)
Glutamine (Gln, Q)
n = 103 (2.71%)
Histidine (His, H)
n = 103 (2.71%)
Lysine (Lys, K)
n = 84 (2.21%)
Arginine (Arg, R)
n = 73 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
123 162 170 51 85 320 49 94 95 8 41 28 93 22 95 119
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
53 8 17 44 99 135 8 31 49 129 30 25 43 127 11 43
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
94 217 5 26 40 100 10 9 41 60 57 16 23 32 115 30
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
73 87 15 25 46 74 10 8 6 58 1 0 0 7 0 105
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
882 990 1148 777
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
508 1027 734 1528
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
261 1074 1811 651

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.