Viewing data for Agkistrodon piscivorus


Scientific name Agkistrodon piscivorus
Common name Water moccasin
Maximum lifespan 24.50 years (Agkistrodon piscivorus@AnAge)

Total mtDNA (size: 17213 bases) GC AT G C A T
Base content (bases) 7278 9935 5041 2237 4333 5602
Base content per 1 kb (bases) 423 577 293 130 252 325
Base content (%) 42.3% 57.7%
Total protein-coding genes (size: 11219 bases) GC AT G C A T
Base content (bases) 4829 6390 3523 1306 2728 3662
Base content per 1 kb (bases) 430 570 314 116 243 326
Base content (%) 43.0% 57.0%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1427 bases) GC AT G C A T
Base content (bases) 588 839 345 243 365 474
Base content per 1 kb (bases) 412 588 242 170 256 332
Base content (%) 41.2% 58.8%
Total rRNA-coding genes (size: 2402 bases) GC AT G C A T
Base content (bases) 1002 1400 594 408 506 894
Base content per 1 kb (bases) 417 583 247 170 211 372
Base content (%) 41.7% 58.3%
12S rRNA gene: No data available for this section.
16S rRNA gene (size: 1487 bases) GC AT G C A T
Base content (bases) 606 881 363 243 326 555
Base content per 1 kb (bases) 408 592 244 163 219 373
Base content (%) 40.8% 59.2%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 302 379 226 76 179 200
Base content per 1 kb (bases) 443 557 332 112 263 294
Base content (%) 44.3% 55.7%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 67 98 54 13 32 66
Base content per 1 kb (bases) 406 594 327 79 194 400
Base content (%) 40.6% 59.4%
COX1 (size: 1546 bases) GC AT G C A T
Base content (bases) 694 852 447 247 416 436
Base content per 1 kb (bases) 449 551 289 160 269 282
Base content (%) 44.9% 55.1%
COX2 (size: 685 bases) GC AT G C A T
Base content (bases) 326 359 216 110 147 212
Base content per 1 kb (bases) 476 524 315 161 215 309
Base content (%) 47.6% 52.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 345 439 225 120 197 242
Base content per 1 kb (bases) 440 560 287 153 251 309
Base content (%) 44.0% 56.0%
CYTB (size: 1114 bases) GC AT G C A T
Base content (bases) 462 652 347 115 309 343
Base content per 1 kb (bases) 415 585 311 103 277 308
Base content (%) 41.5% 58.5%
ND1 (size: 961 bases) GC AT G C A T
Base content (bases) 426 535 310 116 240 295
Base content per 1 kb (bases) 443 557 323 121 250 307
Base content (%) 44.3% 55.7%
ND2 (size: 1030 bases) GC AT G C A T
Base content (bases) 434 596 342 92 226 370
Base content per 1 kb (bases) 421 579 332 89 219 359
Base content (%) 42.1% 57.9%
ND3 (size: 343 bases) GC AT G C A T
Base content (bases) 147 196 105 42 85 111
Base content per 1 kb (bases) 429 571 306 122 248 324
Base content (%) 42.9% 57.1%
ND4 (size: 1338 bases) GC AT G C A T
Base content (bases) 559 779 426 133 324 455
Base content per 1 kb (bases) 418 582 318 99 242 340
Base content (%) 41.8% 58.2%
ND4L (size: 291 bases) GC AT G C A T
Base content (bases) 117 174 87 30 79 95
Base content per 1 kb (bases) 402 598 299 103 271 326
Base content (%) 40.2% 59.8%
ND5 (size: 1788 bases) GC AT G C A T
Base content (bases) 734 1054 554 180 430 624
Base content per 1 kb (bases) 411 589 310 101 240 349
Base content (%) 41.1% 58.9%
ND6 (size: 510 bases) GC AT G C A T
Base content (bases) 220 290 187 33 67 223
Base content per 1 kb (bases) 431 569 367 65 131 437
Base content (%) 43.1% 56.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.54%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 16 (7.08%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 1 (0.44%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 54 (23.89%)
Isoleucine (Ile, I)
n = 14 (6.19%)
Methionine (Met, M)
n = 15 (6.64%)
Proline (Pro, P)
n = 14 (6.19%)
Phenylalanine (Phe, F)
n = 10 (4.42%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 6 (2.65%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 6 (2.65%)
Histidine (His, H)
n = 4 (1.77%)
Lysine (Lys, K)
n = 6 (2.65%)
Arginine (Arg, R)
n = 3 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 8 13 10 11 24 2 3 5 1 0 6 0 3 4 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 4 8 5 0 0 5 3 0 2 5 6 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 9 1 3 6 3 0 2 2 0 4 1 4 3 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 2 0 0 6 0 0 1 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 74 75 38
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
19 67 39 102
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 85 86 39
ATP8 (size: 165 bases)
Amino acid sequence: MPQLDIVHILTIYLWTWTTLTLITLKVKNFTLAVKPKKQPQPTPQQTTPHMPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.85%)
Serine (Ser, S)
n = 0 (0%)
Threonine (Thr, T)
n = 11 (20.37%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.56%)
Leucine (Leu, L)
n = 7 (12.96%)
Isoleucine (Ile, I)
n = 4 (7.41%)
Methionine (Met, M)
n = 2 (3.7%)
Proline (Pro, P)
n = 7 (12.96%)
Phenylalanine (Phe, F)
n = 1 (1.85%)
Tyrosine (Tyr, Y)
n = 1 (1.85%)
Tryptophan (Trp, W)
n = 3 (5.56%)
Aspartic acid (Asp, D)
n = 1 (1.85%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 1 (1.85%)
Glutamine (Gln, Q)
n = 5 (9.26%)
Histidine (His, H)
n = 2 (3.7%)
Lysine (Lys, K)
n = 5 (9.26%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 0 0 2 2 1 2 4 1 1 1 1 0 0 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 0 0 0 0 0 0 1 2 3 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 6 0 0 0 0 0 0 0 0 1 0 0 1 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 1 5 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
5 19 23 8
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 19 16 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 16 27 7
COX1 (size: 1546 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.95%)
Alanine (Ala, A)
n = 36 (7.0%)
Serine (Ser, S)
n = 31 (6.03%)
Threonine (Thr, T)
n = 45 (8.75%)
Cysteine (Cys, C)
n = 2 (0.39%)
Valine (Val, V)
n = 28 (5.45%)
Leucine (Leu, L)
n = 62 (12.06%)
Isoleucine (Ile, I)
n = 47 (9.14%)
Methionine (Met, M)
n = 29 (5.64%)
Proline (Pro, P)
n = 30 (5.84%)
Phenylalanine (Phe, F)
n = 43 (8.37%)
Tyrosine (Tyr, Y)
n = 16 (3.11%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 13 (2.53%)
Glutamic acid (Glu, E)
n = 6 (1.17%)
Asparagine (Asn, N)
n = 18 (3.5%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 19 (3.7%)
Lysine (Lys, K)
n = 12 (2.33%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 34 23 7 10 30 5 8 7 0 7 6 11 4 19 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 2 1 12 21 2 4 13 19 10 4 12 12 2 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 15 2 4 12 9 0 1 5 6 10 4 2 3 15 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 5 1 3 10 11 1 2 2 4 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
129 116 157 113
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
79 136 91 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 195 188 93
COX2 (size: 685 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 24 (10.57%)
Serine (Ser, S)
n = 15 (6.61%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 16 (7.05%)
Leucine (Leu, L)
n = 30 (13.22%)
Isoleucine (Ile, I)
n = 13 (5.73%)
Methionine (Met, M)
n = 9 (3.96%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 8 (3.52%)
Glutamic acid (Glu, E)
n = 17 (7.49%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 11 (4.85%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 8 7 3 7 16 1 3 10 1 2 6 8 0 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 3 0 3 9 10 2 2 3 2 1 1 5 6 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 7 0 0 5 8 0 0 2 1 8 0 0 2 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 13 4 1 7 3 0 0 2 4 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 67 48 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 67 62 75
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 82 102 31
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 17 (6.54%)
Threonine (Thr, T)
n = 27 (10.38%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 18 (6.92%)
Leucine (Leu, L)
n = 36 (13.85%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 11 (4.23%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 18 (6.92%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 5 (1.92%)
Arginine (Arg, R)
n = 4 (1.54%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 9 10 5 8 16 1 6 5 2 0 2 16 0 10 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 1 7 5 2 0 8 8 4 1 1 8 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 10 1 0 3 11 0 1 2 6 6 1 0 0 4 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 1 0 5 5 0 0 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 68 64 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 67 57 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 90 121 36
CYTB (size: 1114 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (5.41%)
Alanine (Ala, A)
n = 23 (6.22%)
Serine (Ser, S)
n = 24 (6.49%)
Threonine (Thr, T)
n = 36 (9.73%)
Cysteine (Cys, C)
n = 2 (0.54%)
Valine (Val, V)
n = 10 (2.7%)
Leucine (Leu, L)
n = 51 (13.78%)
Isoleucine (Ile, I)
n = 41 (11.08%)
Methionine (Met, M)
n = 18 (4.86%)
Proline (Pro, P)
n = 22 (5.95%)
Phenylalanine (Phe, F)
n = 31 (8.38%)
Tyrosine (Tyr, Y)
n = 15 (4.05%)
Tryptophan (Trp, W)
n = 11 (2.97%)
Aspartic acid (Asp, D)
n = 7 (1.89%)
Glutamic acid (Glu, E)
n = 7 (1.89%)
Asparagine (Asn, N)
n = 18 (4.86%)
Glutamine (Gln, Q)
n = 7 (1.89%)
Histidine (His, H)
n = 13 (3.51%)
Lysine (Lys, K)
n = 9 (2.43%)
Arginine (Arg, R)
n = 6 (1.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 31 17 10 7 25 1 8 7 0 2 2 6 0 14 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 5 10 8 0 2 12 6 0 2 7 12 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 16 0 2 9 12 0 1 0 6 9 2 0 8 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 4 3 1 6 9 0 0 1 5 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 91 123 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 104 76 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 152 144 67
ND1 (size: 961 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (5.02%)
Alanine (Ala, A)
n = 25 (7.84%)
Serine (Ser, S)
n = 26 (8.15%)
Threonine (Thr, T)
n = 29 (9.09%)
Cysteine (Cys, C)
n = 2 (0.63%)
Valine (Val, V)
n = 7 (2.19%)
Leucine (Leu, L)
n = 61 (19.12%)
Isoleucine (Ile, I)
n = 21 (6.58%)
Methionine (Met, M)
n = 20 (6.27%)
Proline (Pro, P)
n = 21 (6.58%)
Phenylalanine (Phe, F)
n = 19 (5.96%)
Tyrosine (Tyr, Y)
n = 10 (3.13%)
Tryptophan (Trp, W)
n = 8 (2.51%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 12 (3.76%)
Asparagine (Asn, N)
n = 15 (4.7%)
Glutamine (Gln, Q)
n = 7 (2.19%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 8 (2.51%)
Arginine (Arg, R)
n = 7 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 14 18 7 11 29 3 10 6 1 0 3 3 1 7 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 0 13 11 1 0 6 8 2 4 11 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 13 2 2 12 10 1 0 1 4 6 0 1 1 14 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 3 0 3 8 0 0 1 4 2 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 88 94 75
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 100 58 128
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 122 143 36
ND2 (size: 1030 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (2.92%)
Alanine (Ala, A)
n = 26 (7.6%)
Serine (Ser, S)
n = 28 (8.19%)
Threonine (Thr, T)
n = 62 (18.13%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.34%)
Leucine (Leu, L)
n = 55 (16.08%)
Isoleucine (Ile, I)
n = 36 (10.53%)
Methionine (Met, M)
n = 23 (6.73%)
Proline (Pro, P)
n = 19 (5.56%)
Phenylalanine (Phe, F)
n = 9 (2.63%)
Tyrosine (Tyr, Y)
n = 5 (1.46%)
Tryptophan (Trp, W)
n = 9 (2.63%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.75%)
Asparagine (Asn, N)
n = 14 (4.09%)
Glutamine (Gln, Q)
n = 6 (1.75%)
Histidine (His, H)
n = 9 (2.63%)
Lysine (Lys, K)
n = 12 (3.51%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 22 22 9 8 29 3 6 4 2 0 3 5 0 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 9 11 2 0 3 6 1 0 7 12 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 30 1 0 12 10 1 1 4 1 4 0 0 6 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 0 0 1 11 1 0 0 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 87 152 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 130 53 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 125 165 41
ND3 (size: 1030 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 10 (2.92%)
Alanine (Ala, A)
n = 26 (7.6%)
Serine (Ser, S)
n = 28 (8.19%)
Threonine (Thr, T)
n = 62 (18.13%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.34%)
Leucine (Leu, L)
n = 55 (16.08%)
Isoleucine (Ile, I)
n = 36 (10.53%)
Methionine (Met, M)
n = 23 (6.73%)
Proline (Pro, P)
n = 19 (5.56%)
Phenylalanine (Phe, F)
n = 9 (2.63%)
Tyrosine (Tyr, Y)
n = 5 (1.46%)
Tryptophan (Trp, W)
n = 9 (2.63%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.75%)
Asparagine (Asn, N)
n = 14 (4.09%)
Glutamine (Gln, Q)
n = 6 (1.75%)
Histidine (His, H)
n = 9 (2.63%)
Lysine (Lys, K)
n = 12 (3.51%)
Arginine (Arg, R)
n = 4 (1.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 22 22 9 8 29 3 6 4 2 0 3 5 0 1 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 9 11 2 0 3 6 1 0 7 12 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 30 1 0 12 10 1 1 4 1 4 0 0 6 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 6 0 0 1 11 1 0 0 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 87 152 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 130 53 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 125 165 41
ND4 (size: 1338 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (3.6%)
Alanine (Ala, A)
n = 34 (7.64%)
Serine (Ser, S)
n = 25 (5.62%)
Threonine (Thr, T)
n = 56 (12.58%)
Cysteine (Cys, C)
n = 4 (0.9%)
Valine (Val, V)
n = 5 (1.12%)
Leucine (Leu, L)
n = 88 (19.78%)
Isoleucine (Ile, I)
n = 41 (9.21%)
Methionine (Met, M)
n = 34 (7.64%)
Proline (Pro, P)
n = 26 (5.84%)
Phenylalanine (Phe, F)
n = 18 (4.04%)
Tyrosine (Tyr, Y)
n = 12 (2.7%)
Tryptophan (Trp, W)
n = 10 (2.25%)
Aspartic acid (Asp, D)
n = 3 (0.67%)
Glutamic acid (Glu, E)
n = 9 (2.02%)
Asparagine (Asn, N)
n = 16 (3.6%)
Glutamine (Gln, Q)
n = 17 (3.82%)
Histidine (His, H)
n = 11 (2.47%)
Lysine (Lys, K)
n = 11 (2.47%)
Arginine (Arg, R)
n = 9 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 24 27 10 16 46 5 9 16 1 0 0 4 1 8 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 4 3 16 15 0 0 5 9 2 4 11 11 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 31 1 3 7 11 0 1 3 2 10 1 2 5 11 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 8 1 0 3 10 1 0 3 6 0 1 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 140 163 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 137 79 186
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 149 213 62
ND4L (size: 291 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.13%)
Alanine (Ala, A)
n = 6 (6.25%)
Serine (Ser, S)
n = 7 (7.29%)
Threonine (Thr, T)
n = 11 (11.46%)
Cysteine (Cys, C)
n = 2 (2.08%)
Valine (Val, V)
n = 7 (7.29%)
Leucine (Leu, L)
n = 23 (23.96%)
Isoleucine (Ile, I)
n = 6 (6.25%)
Methionine (Met, M)
n = 10 (10.42%)
Proline (Pro, P)
n = 2 (2.08%)
Phenylalanine (Phe, F)
n = 3 (3.13%)
Tyrosine (Tyr, Y)
n = 1 (1.04%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.04%)
Glutamic acid (Glu, E)
n = 2 (2.08%)
Asparagine (Asn, N)
n = 3 (3.13%)
Glutamine (Gln, Q)
n = 2 (2.08%)
Histidine (His, H)
n = 3 (3.13%)
Lysine (Lys, K)
n = 3 (3.13%)
Arginine (Arg, R)
n = 1 (1.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 4 9 4 6 8 1 4 2 0 2 3 2 0 1 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 1 1 4 0 0 1 2 0 0 0 1 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 2 0 2 0 3 0 0 2 0 1 0 0 0 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 0 1 3 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 27 35 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 24 16 49
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 36 44 14
ND5 (size: 1788 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.2%)
Alanine (Ala, A)
n = 37 (6.22%)
Serine (Ser, S)
n = 47 (7.9%)
Threonine (Thr, T)
n = 84 (14.12%)
Cysteine (Cys, C)
n = 2 (0.34%)
Valine (Val, V)
n = 15 (2.52%)
Leucine (Leu, L)
n = 92 (15.46%)
Isoleucine (Ile, I)
n = 54 (9.08%)
Methionine (Met, M)
n = 46 (7.73%)
Proline (Pro, P)
n = 29 (4.87%)
Phenylalanine (Phe, F)
n = 28 (4.71%)
Tyrosine (Tyr, Y)
n = 10 (1.68%)
Tryptophan (Trp, W)
n = 9 (1.51%)
Aspartic acid (Asp, D)
n = 9 (1.51%)
Glutamic acid (Glu, E)
n = 12 (2.02%)
Asparagine (Asn, N)
n = 31 (5.21%)
Glutamine (Gln, Q)
n = 19 (3.19%)
Histidine (His, H)
n = 13 (2.18%)
Lysine (Lys, K)
n = 26 (4.37%)
Arginine (Arg, R)
n = 7 (1.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 29 39 14 24 38 4 11 18 1 3 6 5 1 6 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 1 5 16 14 2 3 7 9 6 7 9 13 0 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
32 36 3 6 12 18 0 1 10 3 7 1 1 6 25 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 11 1 1 8 25 1 0 2 5 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
98 148 252 98
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 186 121 235
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 220 251 97
ND6 (size: 510 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (17.75%)
Alanine (Ala, A)
n = 9 (5.33%)
Serine (Ser, S)
n = 6 (3.55%)
Threonine (Thr, T)
n = 4 (2.37%)
Cysteine (Cys, C)
n = 7 (4.14%)
Valine (Val, V)
n = 36 (21.3%)
Leucine (Leu, L)
n = 21 (12.43%)
Isoleucine (Ile, I)
n = 4 (2.37%)
Methionine (Met, M)
n = 8 (4.73%)
Proline (Pro, P)
n = 2 (1.18%)
Phenylalanine (Phe, F)
n = 14 (8.28%)
Tyrosine (Tyr, Y)
n = 11 (6.51%)
Tryptophan (Trp, W)
n = 5 (2.96%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (2.96%)
Asparagine (Asn, N)
n = 1 (0.59%)
Glutamine (Gln, Q)
n = 1 (0.59%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 1 (0.59%)
Arginine (Arg, R)
n = 4 (2.37%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 2 1 0 0 2 8 0 1 14 1 6 15 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 7 0 4 1 1 3 13 1 3 13 2 0 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 0 4 0 0 0 2 0 11 0 3 10 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 3 0 0 1 0 3 0 0 1 0 1 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 10 21 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 19 19 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
58 4 27 81
Total protein-coding genes (size: 11236 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 208 (5.56%)
Alanine (Ala, A)
n = 260 (6.95%)
Serine (Ser, S)
n = 249 (6.65%)
Threonine (Thr, T)
n = 416 (11.12%)
Cysteine (Cys, C)
n = 28 (0.75%)
Valine (Val, V)
n = 164 (4.38%)
Leucine (Leu, L)
n = 603 (16.11%)
Isoleucine (Ile, I)
n = 309 (8.26%)
Methionine (Met, M)
n = 231 (6.17%)
Proline (Pro, P)
n = 205 (5.48%)
Phenylalanine (Phe, F)
n = 206 (5.51%)
Tyrosine (Tyr, Y)
n = 109 (2.91%)
Tryptophan (Trp, W)
n = 95 (2.54%)
Aspartic acid (Asp, D)
n = 54 (1.44%)
Glutamic acid (Glu, E)
n = 95 (2.54%)
Asparagine (Asn, N)
n = 142 (3.79%)
Glutamine (Gln, Q)
n = 97 (2.59%)
Histidine (His, H)
n = 102 (2.73%)
Lysine (Lys, K)
n = 104 (2.78%)
Arginine (Arg, R)
n = 60 (1.6%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
114 195 193 84 113 275 31 80 86 11 31 40 68 25 88 118
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
38 13 15 32 106 108 14 24 68 77 39 28 74 94 9 54
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
167 184 11 27 80 95 2 11 34 40 69 14 20 37 105 26
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
76 75 20 7 47 100 4 5 13 39 3 1 1 4 0 81
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
781 967 1249 746
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
438 1085 707 1513
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
242 1320 1560 621

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.