Viewing data for Urocyon cinereoargenteus


Scientific name Urocyon cinereoargenteus
Common name Gray fox
Maximum lifespan 16.20 years (Urocyon cinereoargenteus@AnAge)

Total mtDNA (size: 16469 bases) GC AT G C A T
Base content (bases) 6848 9621 4339 2509 4551 5070
Base content per 1 kb (bases) 416 584 263 152 276 308
Base content (%) 41.6% 58.4%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4786 6552 3167 1619 3199 3353
Base content per 1 kb (bases) 422 578 279 143 282 296
Base content (%) 42.2% 57.8%
D-loop (size: 1004 bases) GC AT G C A T
Base content (bases) 448 556 283 165 285 271
Base content per 1 kb (bases) 446 554 282 164 284 270
Base content (%) 44.6% 55.4%
Total tRNA-coding genes (size: 1511 bases) GC AT G C A T
Base content (bases) 565 946 317 248 431 515
Base content per 1 kb (bases) 374 626 210 164 285 341
Base content (%) 37.4% 62.6%
Total rRNA-coding genes (size: 2541 bases) GC AT G C A T
Base content (bases) 1014 1527 553 461 622 905
Base content per 1 kb (bases) 399 601 218 181 245 356
Base content (%) 39.9% 60.1%
12S rRNA gene (size: 958 bases) GC AT G C A T
Base content (bases) 404 554 224 180 219 335
Base content per 1 kb (bases) 422 578 234 188 229 350
Base content (%) 42.2% 57.8%
16S rRNA gene (size: 1583 bases) GC AT G C A T
Base content (bases) 610 973 329 281 403 570
Base content per 1 kb (bases) 385 615 208 178 255 360
Base content (%) 38.5% 61.5%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 281 400 190 91 204 196
Base content per 1 kb (bases) 413 587 279 134 300 288
Base content (%) 41.3% 58.7%
ATP8 (size: 204 bases) GC AT G C A T
Base content (bases) 71 133 53 18 58 75
Base content per 1 kb (bases) 348 652 260 88 284 368
Base content (%) 34.8% 65.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 674 871 372 302 476 395
Base content per 1 kb (bases) 436 564 241 195 308 256
Base content (%) 43.6% 56.4%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 284 400 182 102 181 219
Base content per 1 kb (bases) 415 585 266 149 265 320
Base content (%) 41.5% 58.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 353 431 215 138 229 202
Base content per 1 kb (bases) 450 550 274 176 292 258
Base content (%) 45.0% 55.0%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 500 640 336 164 312 328
Base content per 1 kb (bases) 439 561 295 144 274 288
Base content (%) 43.9% 56.1%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 432 524 300 132 268 256
Base content per 1 kb (bases) 452 548 314 138 280 268
Base content (%) 45.2% 54.8%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 420 622 305 115 276 346
Base content per 1 kb (bases) 403 597 293 110 265 332
Base content (%) 40.3% 59.7%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 139 207 88 51 102 105
Base content per 1 kb (bases) 402 598 254 147 295 303
Base content (%) 40.2% 59.8%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 559 819 391 168 398 421
Base content per 1 kb (bases) 406 594 284 122 289 306
Base content (%) 40.6% 59.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 118 179 73 45 96 83
Base content per 1 kb (bases) 397 603 246 152 323 279
Base content (%) 39.7% 60.3%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 770 1051 529 241 503 548
Base content per 1 kb (bases) 423 577 290 132 276 301
Base content (%) 42.3% 57.7%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 210 318 150 60 115 203
Base content per 1 kb (bases) 398 602 284 114 218 384
Base content (%) 39.8% 60.2%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 18 (7.96%)
Serine (Ser, S)
n = 14 (6.19%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 42 (18.58%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 12 (5.31%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 10 (4.42%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 9 9 2 6 16 6 8 9 1 3 1 4 2 5 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 5 7 5 1 1 4 3 3 2 6 5 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 9 1 6 1 3 1 1 2 1 2 2 4 7 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 0 1 2 2 1 1 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 63 78 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 64 39 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 63 79 58
ATP8 (size: 204 bases)
Amino acid sequence: MPQLNTSTWFITIISMIITLFILFQLKVSKHCYPKNPELKPTEKVNQYIPWKNKWTKIYSPLSLPHQ*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 5 (7.46%)
Threonine (Thr, T)
n = 6 (8.96%)
Cysteine (Cys, C)
n = 1 (1.49%)
Valine (Val, V)
n = 2 (2.99%)
Leucine (Leu, L)
n = 7 (10.45%)
Isoleucine (Ile, I)
n = 8 (11.94%)
Methionine (Met, M)
n = 2 (2.99%)
Proline (Pro, P)
n = 7 (10.45%)
Phenylalanine (Phe, F)
n = 3 (4.48%)
Tyrosine (Tyr, Y)
n = 3 (4.48%)
Tryptophan (Trp, W)
n = 3 (4.48%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (2.99%)
Asparagine (Asn, N)
n = 4 (5.97%)
Glutamine (Gln, Q)
n = 4 (5.97%)
Histidine (His, H)
n = 2 (2.99%)
Lysine (Lys, K)
n = 8 (11.94%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 2 1 1 2 2 1 1 2 2 1 1 0 0 2 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 0 0 0 0 0 0 0 0 3 2 1 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 2 1 0 1 2 2 0 0 1 2 0 0 1 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 1 1 0 0 7 1 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 19 28 17
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 18 24 22
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 16 23 19
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 42 (8.17%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 58 (11.28%)
Isoleucine (Ile, I)
n = 38 (7.39%)
Methionine (Met, M)
n = 33 (6.42%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.31%)
Glutamine (Gln, Q)
n = 7 (1.36%)
Histidine (His, H)
n = 18 (3.5%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 13 20 8 7 20 5 12 3 4 9 6 16 6 17 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
13 1 0 13 12 13 4 11 5 20 11 12 8 3 5 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 13 6 9 7 8 3 0 3 9 10 5 6 8 9 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 7 3 6 9 7 2 0 0 6 2 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 101 138 125
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 135 96 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
75 136 161 143
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 9 (3.96%)
Serine (Ser, S)
n = 18 (7.93%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 14 (6.17%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 11 10 5 4 13 2 9 5 2 4 5 5 0 5 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 2 2 2 4 1 0 4 4 0 4 3 6 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 4 3 3 5 5 1 1 3 3 8 2 1 2 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 13 2 0 10 4 0 0 0 6 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
56 57 66 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 61 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 71 92 44
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 23 (8.85%)
Threonine (Thr, T)
n = 21 (8.08%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 20 (7.69%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 12 (4.62%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 10 (3.85%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 14 (5.38%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 6 (2.31%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 9 9 4 9 7 3 9 4 3 3 6 6 5 8 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 3 8 4 0 2 4 13 2 2 2 4 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 9 3 5 6 6 2 1 3 8 6 3 0 4 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 2 2 1 1 1 0 1 4 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 61 55 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 65 56 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 89 91 54
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.6%)
Alanine (Ala, A)
n = 26 (6.86%)
Serine (Ser, S)
n = 26 (6.86%)
Threonine (Thr, T)
n = 26 (6.86%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 15 (3.96%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 41 (10.82%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 27 (7.12%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 17 (4.49%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 27 11 6 9 24 7 9 4 2 3 4 4 4 8 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 2 1 14 7 4 2 5 17 1 4 9 8 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 12 0 4 4 14 1 1 2 8 7 1 2 3 14 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 6 0 3 8 7 2 0 2 6 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 94 111 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 97 76 154
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 145 141 66
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 23 (7.26%)
Threonine (Thr, T)
n = 21 (6.62%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 16 (5.05%)
Leucine (Leu, L)
n = 57 (17.98%)
Isoleucine (Ile, I)
n = 29 (9.15%)
Methionine (Met, M)
n = 17 (5.36%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 11 (3.47%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 6 (1.89%)
Histidine (His, H)
n = 4 (1.26%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 19 14 3 17 17 6 9 5 1 3 5 7 1 8 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 5 13 10 0 1 3 5 3 4 10 6 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 7 1 7 9 4 1 0 2 4 7 1 5 3 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 7 4 1 2 6 1 0 1 6 1 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 83 89 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 92 55 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 125 111 52
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 19 (5.49%)
Serine (Ser, S)
n = 32 (9.25%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 55 (15.9%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 34 (9.83%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 4 (1.16%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 12 (3.47%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 25 27 3 7 28 3 10 7 2 2 6 3 0 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 4 8 6 1 0 6 8 1 4 5 8 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 18 4 4 19 4 2 0 3 2 7 2 4 5 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 2 2 13 2 0 0 3 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 77 141 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 107 58 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 121 147 49
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 15 (4.34%)
Alanine (Ala, A)
n = 19 (5.49%)
Serine (Ser, S)
n = 32 (9.25%)
Threonine (Thr, T)
n = 40 (11.56%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.18%)
Leucine (Leu, L)
n = 55 (15.9%)
Isoleucine (Ile, I)
n = 37 (10.69%)
Methionine (Met, M)
n = 34 (9.83%)
Proline (Pro, P)
n = 19 (5.49%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 4 (1.16%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 12 (3.47%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 15 (4.34%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 25 27 3 7 28 3 10 7 2 2 6 3 0 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 1 4 8 6 1 0 6 8 1 4 5 8 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 18 4 4 19 4 2 0 3 2 7 2 4 5 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 2 2 13 2 0 0 3 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 77 141 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 107 58 150
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 121 147 49
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 32 (6.99%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 36 (7.86%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 13 (2.84%)
Leucine (Leu, L)
n = 94 (20.52%)
Isoleucine (Ile, I)
n = 44 (9.61%)
Methionine (Met, M)
n = 33 (7.21%)
Proline (Pro, P)
n = 24 (5.24%)
Phenylalanine (Phe, F)
n = 17 (3.71%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 21 (4.59%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 12 (2.62%)
Lysine (Lys, K)
n = 13 (2.84%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 25 26 19 13 34 8 18 8 3 3 2 8 0 6 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 1 3 11 15 3 4 3 8 2 5 8 8 3 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 16 1 5 14 6 4 5 5 7 8 3 2 8 13 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 3 2 2 11 2 1 2 7 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 131 157 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 121 84 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 139 180 99
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 4 (4.08%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 6 (6.12%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 3 7 2 3 9 4 3 2 0 1 0 6 1 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 0 3 1 2 0 2 1 1 0 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 0 2 5 2 0 0 1 4 0 0 1 2 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 24 29 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 20 18 52
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 29 36 19
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.12%)
Alanine (Ala, A)
n = 47 (7.76%)
Serine (Ser, S)
n = 47 (7.76%)
Threonine (Thr, T)
n = 53 (8.75%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 18 (2.97%)
Leucine (Leu, L)
n = 93 (15.35%)
Isoleucine (Ile, I)
n = 56 (9.24%)
Methionine (Met, M)
n = 39 (6.44%)
Proline (Pro, P)
n = 25 (4.13%)
Phenylalanine (Phe, F)
n = 39 (6.44%)
Tyrosine (Tyr, Y)
n = 21 (3.47%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 12 (1.98%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 28 (4.62%)
Glutamine (Gln, Q)
n = 20 (3.3%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 25 (4.13%)
Arginine (Arg, R)
n = 11 (1.82%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 38 29 20 18 33 5 16 14 6 2 4 9 3 18 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 1 5 4 23 18 2 8 8 10 5 7 9 7 2 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 15 3 4 18 10 4 3 8 11 10 3 1 9 19 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 4 5 7 24 1 2 3 4 2 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
119 144 212 132
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 161 130 245
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
51 224 206 126
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (12.57%)
Alanine (Ala, A)
n = 11 (6.29%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 12 (6.86%)
Cysteine (Cys, C)
n = 2 (1.14%)
Valine (Val, V)
n = 20 (11.43%)
Leucine (Leu, L)
n = 21 (12.0%)
Isoleucine (Ile, I)
n = 16 (9.14%)
Methionine (Met, M)
n = 9 (5.14%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 12 (6.86%)
Tyrosine (Tyr, Y)
n = 9 (5.14%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 1 2 3 0 2 4 7 0 1 4 1 5 10 11 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 0 7 0 1 3 9 3 4 6 2 0 1 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 2 4 1 0 1 4 1 7 2 2 5 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 7 2 2 2 2 1 0 0 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 14 50 46
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 32 32 78
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
50 14 33 79
Total protein-coding genes (size: 11406 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 216 (5.69%)
Alanine (Ala, A)
n = 265 (6.98%)
Serine (Ser, S)
n = 285 (7.5%)
Threonine (Thr, T)
n = 306 (8.05%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 188 (4.95%)
Leucine (Leu, L)
n = 595 (15.66%)
Isoleucine (Ile, I)
n = 337 (8.87%)
Methionine (Met, M)
n = 241 (6.34%)
Proline (Pro, P)
n = 193 (5.08%)
Phenylalanine (Phe, F)
n = 225 (5.92%)
Tyrosine (Tyr, Y)
n = 137 (3.61%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 71 (1.87%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 149 (3.92%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 96 (2.53%)
Lysine (Lys, K)
n = 104 (2.74%)
Arginine (Arg, R)
n = 66 (1.74%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
152 185 173 80 99 211 57 116 64 28 40 41 75 32 99 126
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
68 10 17 49 104 90 22 38 48 94 36 51 65 58 19 55
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
110 116 25 55 91 65 23 17 34 65 72 25 32 57 92 35
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
61 67 28 25 46 87 17 5 11 45 5 1 0 7 0 79
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
835 894 1189 882
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
465 998 751 1586
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
417 1202 1348 833

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.