Viewing data for Capra nubiana


Scientific name Capra nubiana
Common name Nubian ibex
Maximum lifespan 22.40 years (Capra nubiana@AnAge)

Total mtDNA (size: 16705 bases) GC AT G C A T
Base content (bases) 6583 10112 4390 2193 4511 5601
Base content per 1 kb (bases) 394 605 263 131 270 335
Base content (%) 39.4% 60.5%
Total protein-coding genes (size: 11335 bases) GC AT G C A T
Base content (bases) 4506 6819 3185 1321 3114 3705
Base content per 1 kb (bases) 398 602 281 117 275 327
Base content (%) 39.8% 60.2%
D-loop (size: 1099 bases) GC AT G C A T
Base content (bases) 440 659 271 169 307 352
Base content per 1 kb (bases) 400 600 247 154 279 320
Base content (%) 40.0% 60.0%
Total tRNA-coding genes (size: 1511 bases) GC AT G C A T
Base content (bases) 542 969 314 228 432 537
Base content per 1 kb (bases) 359 641 208 151 286 355
Base content (%) 35.9% 64.1%
Total rRNA-coding genes (size: 2530 bases) GC AT G C A T
Base content (bases) 996 1534 552 444 594 940
Base content per 1 kb (bases) 394 606 218 175 235 372
Base content (%) 39.4% 60.6%
12S rRNA gene (size: 956 bases) GC AT G C A T
Base content (bases) 398 558 225 173 210 348
Base content per 1 kb (bases) 416 584 235 181 220 364
Base content (%) 41.6% 58.4%
16S rRNA gene (size: 1574 bases) GC AT G C A T
Base content (bases) 598 976 327 271 384 592
Base content per 1 kb (bases) 380 620 208 172 244 376
Base content (%) 38.0% 62.0%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 268 413 196 72 190 223
Base content per 1 kb (bases) 394 606 288 106 279 327
Base content (%) 39.4% 60.6%
ATP8 (size: 198 bases) GC AT G C A T
Base content (bases) 64 134 51 13 53 81
Base content per 1 kb (bases) 323 677 258 66 268 409
Base content (%) 32.3% 67.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 639 906 392 247 458 448
Base content per 1 kb (bases) 414 586 254 160 296 290
Base content (%) 41.4% 58.6%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 261 423 166 95 186 237
Base content per 1 kb (bases) 382 618 243 139 272 346
Base content (%) 38.2% 61.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 341 439 227 114 231 208
Base content per 1 kb (bases) 435 560 290 145 295 265
Base content (%) 43.5% 56.0%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 477 663 331 146 298 365
Base content per 1 kb (bases) 418 582 290 128 261 320
Base content (%) 41.8% 58.2%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 390 563 280 110 262 301
Base content per 1 kb (bases) 408 589 293 115 274 315
Base content (%) 40.8% 58.9%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 382 660 302 80 274 386
Base content per 1 kb (bases) 367 633 290 77 263 370
Base content (%) 36.7% 63.3%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 138 208 101 37 99 109
Base content per 1 kb (bases) 399 601 292 107 286 315
Base content (%) 39.9% 60.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 555 823 405 150 386 437
Base content per 1 kb (bases) 403 597 294 109 280 317
Base content (%) 40.3% 59.7%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 111 186 77 34 91 95
Base content per 1 kb (bases) 374 626 259 114 306 320
Base content (%) 37.4% 62.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 717 1104 525 192 491 613
Base content per 1 kb (bases) 394 606 288 105 270 337
Base content (%) 39.4% 60.6%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 182 343 145 37 118 225
Base content per 1 kb (bases) 345 650 275 70 223 426
Base content (%) 34.5% 65.0%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 16 (7.08%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.54%)
Leucine (Leu, L)
n = 45 (19.91%)
Isoleucine (Ile, I)
n = 25 (11.06%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 13 (5.75%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 9 9 5 10 17 2 10 9 0 1 1 4 2 9 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 2 7 8 0 0 3 8 0 2 6 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 15 1 3 1 6 0 2 4 0 2 0 1 3 8 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 0 0 1 4 0 1 1 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 66 82 39
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 65 37 101
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 65 104 50
ATP8 (size: 198 bases)
Amino acid sequence: MPQLDTSTWLTTILSMFLALFIIFQLKISKYNFYHNPELTAKALKQNTPWETKWTKIYLPLLLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (4.62%)
Serine (Ser, S)
n = 3 (4.62%)
Threonine (Thr, T)
n = 8 (12.31%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 13 (20.0%)
Isoleucine (Ile, I)
n = 5 (7.69%)
Methionine (Met, M)
n = 2 (3.08%)
Proline (Pro, P)
n = 5 (7.69%)
Phenylalanine (Phe, F)
n = 4 (6.15%)
Tyrosine (Tyr, Y)
n = 3 (4.62%)
Tryptophan (Trp, W)
n = 3 (4.62%)
Aspartic acid (Asp, D)
n = 1 (1.54%)
Glutamic acid (Glu, E)
n = 2 (3.08%)
Asparagine (Asn, N)
n = 3 (4.62%)
Glutamine (Gln, Q)
n = 3 (4.62%)
Histidine (His, H)
n = 1 (1.54%)
Lysine (Lys, K)
n = 6 (9.23%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 1 2 1 6 0 4 3 0 0 0 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 0 2 0 0 0 0 0 2 1 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 6 1 0 0 3 0 0 0 1 2 0 0 0 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 5 1 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 18 24 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 19 20 24
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 14 37 11
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 31 (6.03%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 35 (6.81%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 40 (7.78%)
Methionine (Met, M)
n = 34 (6.61%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 16 (3.11%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 18 (3.5%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 17 29 12 5 27 4 11 5 1 7 6 20 2 19 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 1 8 15 17 0 7 9 26 5 10 10 8 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 18 0 7 7 12 1 1 3 9 10 2 0 9 9 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 1 5 11 9 0 1 1 4 2 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
147 107 143 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 133 95 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 152 210 130
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 13 (5.73%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 7 (3.08%)
Tyrosine (Tyr, Y)
n = 9 (3.96%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 8 (3.52%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 6 11 2 3 17 3 8 4 2 6 1 6 0 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 1 1 6 0 2 2 3 1 1 5 7 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 10 1 4 3 8 1 1 4 6 3 1 0 1 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 14 1 2 8 6 0 2 0 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 58 68 48
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 60 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 53 109 51
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 17 (6.54%)
Serine (Ser, S)
n = 19 (7.31%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 14 (5.38%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 6 4 7 7 10 0 8 6 1 3 5 7 0 10 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 5 9 3 0 6 6 7 0 0 6 5 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 0 1 7 6 1 1 3 6 4 0 0 4 3 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 0 1 3 2 0 2 1 2 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 65 58 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 67 55 93
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 95 92 63
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 23 (6.07%)
Serine (Ser, S)
n = 20 (5.28%)
Threonine (Thr, T)
n = 29 (7.65%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 18 (4.75%)
Leucine (Leu, L)
n = 55 (14.51%)
Isoleucine (Ile, I)
n = 42 (11.08%)
Methionine (Met, M)
n = 18 (4.75%)
Proline (Pro, P)
n = 24 (6.33%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 21 16 5 15 24 5 6 3 3 1 7 10 0 7 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 3 1 6 16 0 0 7 16 1 4 6 13 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 19 0 3 4 10 0 0 3 7 8 0 0 4 14 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 0 2 9 9 0 0 1 7 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 99 120 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 93 77 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 139 168 61
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 22 (6.94%)
Threonine (Thr, T)
n = 20 (6.31%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 12 (3.79%)
Leucine (Leu, L)
n = 56 (17.67%)
Isoleucine (Ile, I)
n = 33 (10.41%)
Methionine (Met, M)
n = 20 (6.31%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 20 (6.31%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 12 (3.79%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 16 18 2 14 26 2 11 6 1 1 3 5 3 6 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 4 11 12 1 0 6 5 1 3 11 7 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 14 0 0 6 13 0 0 3 6 6 1 0 5 7 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 11 0 1 2 6 1 1 0 7 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 83 94 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 88 55 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 107 149 48
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 40 (11.56%)
Methionine (Met, M)
n = 39 (11.27%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 24 37 2 15 30 0 9 9 0 1 3 4 0 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 8 6 0 1 4 9 0 2 6 11 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 18 1 3 7 13 2 0 2 4 4 0 0 6 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 0 0 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 86 151 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 103 57 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 113 178 50
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 17 (4.91%)
Serine (Ser, S)
n = 27 (7.8%)
Threonine (Thr, T)
n = 41 (11.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 56 (16.18%)
Isoleucine (Ile, I)
n = 40 (11.56%)
Methionine (Met, M)
n = 39 (11.27%)
Proline (Pro, P)
n = 20 (5.78%)
Phenylalanine (Phe, F)
n = 14 (4.05%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 16 (4.62%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 24 37 2 15 30 0 9 9 0 1 3 4 0 6 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 8 6 0 1 4 9 0 2 6 11 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 18 1 3 7 13 2 0 2 4 4 0 0 6 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 0 0 0 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
44 86 151 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
30 103 57 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 113 178 50
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 28 (6.11%)
Serine (Ser, S)
n = 41 (8.95%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 16 (3.49%)
Leucine (Leu, L)
n = 92 (20.09%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 21 (4.59%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 22 30 19 14 43 3 12 10 1 2 8 6 0 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 3 11 14 0 1 8 8 1 3 8 11 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 19 3 6 10 12 0 1 12 7 8 0 1 6 15 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 5 3 1 3 11 0 3 1 3 3 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 135 157 93
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
57 116 83 203
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 154 197 89
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 6 (6.12%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 13 (13.27%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 10 1 3 11 1 6 2 0 1 0 5 0 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 1 2 5 0 1 1 2 0 1 0 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 2 5 2 0 0 1 1 3 0 0 2 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 2 0 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
21 22 29 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 23 17 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 32 49 14
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 42 (6.93%)
Serine (Ser, S)
n = 44 (7.26%)
Threonine (Thr, T)
n = 59 (9.74%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 17 (2.81%)
Leucine (Leu, L)
n = 87 (14.36%)
Isoleucine (Ile, I)
n = 61 (10.07%)
Methionine (Met, M)
n = 37 (6.11%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 47 (7.76%)
Tyrosine (Tyr, Y)
n = 18 (2.97%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 37 (6.11%)
Glutamine (Gln, Q)
n = 18 (2.97%)
Histidine (His, H)
n = 14 (2.31%)
Lysine (Lys, K)
n = 23 (3.8%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
31 30 35 9 17 42 4 15 16 2 4 6 7 0 15 32
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 3 5 16 20 1 0 10 18 0 3 10 12 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 30 2 6 15 13 1 4 5 11 7 2 0 8 29 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 2 1 9 20 3 0 4 5 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
109 139 226 133
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
63 162 133 249
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 224 254 109
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 8 (4.57%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 25 (14.29%)
Leucine (Leu, L)
n = 17 (9.71%)
Isoleucine (Ile, I)
n = 14 (8.0%)
Methionine (Met, M)
n = 13 (7.43%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 8 (4.57%)
Asparagine (Asn, N)
n = 3 (1.71%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 5 (2.86%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 0 6 1 0 2 0 9 1 0 13 0 7 5 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 3 2 0 1 11 1 3 11 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 2 5 0 1 0 5 0 9 1 1 5 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 6 4 0 2 2 1 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 8 46 50
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 23 31 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
39 5 38 91
Total protein-coding genes (size: 11400 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 246 (6.48%)
Serine (Ser, S)
n = 272 (7.16%)
Threonine (Thr, T)
n = 325 (8.56%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 177 (4.66%)
Leucine (Leu, L)
n = 594 (15.64%)
Isoleucine (Ile, I)
n = 342 (9.01%)
Methionine (Met, M)
n = 251 (6.61%)
Proline (Pro, P)
n = 195 (5.14%)
Phenylalanine (Phe, F)
n = 243 (6.4%)
Tyrosine (Tyr, Y)
n = 129 (3.4%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 67 (1.76%)
Glutamic acid (Glu, E)
n = 95 (2.5%)
Asparagine (Asn, N)
n = 161 (4.24%)
Glutamine (Gln, Q)
n = 88 (2.32%)
Histidine (His, H)
n = 99 (2.61%)
Lysine (Lys, K)
n = 98 (2.58%)
Arginine (Arg, R)
n = 65 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
185 157 211 74 109 267 24 111 77 11 41 40 84 12 101 142
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
38 5 18 39 93 111 3 29 57 108 20 34 72 84 4 51
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
93 170 11 41 66 101 6 15 42 68 60 7 7 52 109 28
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
71 81 14 18 49 90 7 11 10 39 5 1 0 6 1 97
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
799 920 1232 837
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
464 979 742 1603
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
170 1188 1638 792

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.