Viewing data for Callithrix geoffroyi


Scientific name Callithrix geoffroyi
Common name Geoffroy's marmoset
Maximum lifespan 17.60 years (Callithrix geoffroyi@AnAge)

Total mtDNA (size: 16502 bases) GC AT G C A T
Base content (bases) 6678 9824 4454 2224 4427 5397
Base content per 1 kb (bases) 405 595 270 135 268 327
Base content (%) 40.5% 59.5%
Total protein-coding genes (size: 11335 bases) GC AT G C A T
Base content (bases) 4625 6710 3247 1378 3105 3605
Base content per 1 kb (bases) 408 592 286 122 274 318
Base content (%) 40.8% 59.2%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1503 bases) GC AT G C A T
Base content (bases) 541 962 309 232 433 529
Base content per 1 kb (bases) 360 640 206 154 288 352
Base content (%) 36.0% 64.0%
Total rRNA-coding genes (size: 2503 bases) GC AT G C A T
Base content (bases) 1028 1475 588 440 594 881
Base content per 1 kb (bases) 411 589 235 176 237 352
Base content (%) 41.1% 58.9%
12S rRNA gene (size: 949 bases) GC AT G C A T
Base content (bases) 414 535 235 179 214 321
Base content per 1 kb (bases) 436 564 248 189 226 338
Base content (%) 43.6% 56.4%
16S rRNA gene (size: 1554 bases) GC AT G C A T
Base content (bases) 614 940 353 261 380 560
Base content per 1 kb (bases) 395 605 227 168 245 360
Base content (%) 39.5% 60.5%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 270 411 201 69 196 215
Base content per 1 kb (bases) 396 604 295 101 288 316
Base content (%) 39.6% 60.4%
ATP8 (size: 207 bases) GC AT G C A T
Base content (bases) 68 139 53 15 58 81
Base content per 1 kb (bases) 329 671 256 72 280 391
Base content (%) 32.9% 67.1%
COX1 (size: 1540 bases) GC AT G C A T
Base content (bases) 654 886 398 256 457 429
Base content per 1 kb (bases) 425 575 258 166 297 279
Base content (%) 42.5% 57.5%
COX2 (size: 688 bases) GC AT G C A T
Base content (bases) 281 407 185 96 186 221
Base content per 1 kb (bases) 408 592 269 140 270 321
Base content (%) 40.8% 59.2%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 338 446 221 117 221 225
Base content per 1 kb (bases) 431 569 282 149 282 287
Base content (%) 43.1% 56.9%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 513 627 355 158 302 325
Base content per 1 kb (bases) 450 550 311 139 265 285
Base content (%) 45.0% 55.0%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 404 552 299 105 250 302
Base content per 1 kb (bases) 423 577 313 110 262 316
Base content (%) 42.3% 57.7%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 407 632 323 84 251 381
Base content per 1 kb (bases) 392 608 311 81 242 367
Base content (%) 39.2% 60.8%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 139 207 102 37 98 109
Base content per 1 kb (bases) 402 598 295 107 283 315
Base content (%) 40.2% 59.8%
ND4 (size: 1375 bases) GC AT G C A T
Base content (bases) 535 840 388 147 391 449
Base content per 1 kb (bases) 389 611 282 107 284 327
Base content (%) 38.9% 61.1%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 107 190 74 33 96 94
Base content per 1 kb (bases) 360 640 249 111 323 316
Base content (%) 36.0% 64.0%
ND5 (size: 1806 bases) GC AT G C A T
Base content (bases) 715 1091 508 207 504 587
Base content per 1 kb (bases) 396 604 281 115 279 325
Base content (%) 39.6% 60.4%
ND6 (size: 534 bases) GC AT G C A T
Base content (bases) 214 320 154 60 113 207
Base content per 1 kb (bases) 401 599 288 112 212 388
Base content (%) 40.1% 59.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.98%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 13 (5.75%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.54%)
Leucine (Leu, L)
n = 46 (20.35%)
Isoleucine (Ile, I)
n = 29 (12.83%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 10 (4.42%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 2 (0.88%)
Glutamic acid (Glu, E)
n = 2 (0.88%)
Asparagine (Asn, N)
n = 12 (5.31%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 5 (2.21%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 13 8 5 12 19 5 5 9 0 1 0 5 2 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 5 4 8 0 2 2 4 1 2 5 5 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 13 0 3 6 2 0 0 2 2 2 0 0 7 5 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 2 4 0 0 0 4 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 71 84 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
18 64 39 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 66 92 56
ATP8 (size: 207 bases)
Amino acid sequence: VPQLNISPWPMVILSMIVTLFFITQLKLLNFTFYTTPTPKLTKTQKHKSTWELKWTKIYSLPSMSQQS*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 7 (10.29%)
Threonine (Thr, T)
n = 10 (14.71%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (4.41%)
Leucine (Leu, L)
n = 9 (13.24%)
Isoleucine (Ile, I)
n = 5 (7.35%)
Methionine (Met, M)
n = 3 (4.41%)
Proline (Pro, P)
n = 6 (8.82%)
Phenylalanine (Phe, F)
n = 4 (5.88%)
Tyrosine (Tyr, Y)
n = 2 (2.94%)
Tryptophan (Trp, W)
n = 3 (4.41%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.47%)
Asparagine (Asn, N)
n = 2 (2.94%)
Glutamine (Gln, Q)
n = 5 (7.35%)
Histidine (His, H)
n = 1 (1.47%)
Lysine (Lys, K)
n = 7 (10.29%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 2 1 0 4 0 4 4 1 0 0 0 3 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 1 0 5 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 2 0 1 1 4 1 0 0 1 1 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 0 6 1 0 0 0 0 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
4 17 27 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 23 19 24
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 13 35 13
COX1 (size: 1540 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 45 (8.79%)
Alanine (Ala, A)
n = 37 (7.23%)
Serine (Ser, S)
n = 35 (6.84%)
Threonine (Thr, T)
n = 39 (7.62%)
Cysteine (Cys, C)
n = 1 (0.2%)
Valine (Val, V)
n = 37 (7.23%)
Leucine (Leu, L)
n = 60 (11.72%)
Isoleucine (Ile, I)
n = 38 (7.42%)
Methionine (Met, M)
n = 30 (5.86%)
Proline (Pro, P)
n = 28 (5.47%)
Phenylalanine (Phe, F)
n = 41 (8.01%)
Tyrosine (Tyr, Y)
n = 21 (4.1%)
Tryptophan (Trp, W)
n = 16 (3.13%)
Aspartic acid (Asp, D)
n = 15 (2.93%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 17 (3.32%)
Glutamine (Gln, Q)
n = 7 (1.37%)
Histidine (His, H)
n = 18 (3.52%)
Lysine (Lys, K)
n = 10 (1.95%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
23 15 20 10 6 25 2 15 5 2 6 6 22 3 23 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 1 8 11 17 1 9 16 13 7 4 10 13 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 16 2 7 11 12 1 0 4 7 14 3 2 8 9 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 6 4 5 10 10 0 0 2 6 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
144 104 138 127
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 135 98 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 159 193 123
COX2 (size: 688 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 18 (7.89%)
Serine (Ser, S)
n = 18 (7.89%)
Threonine (Thr, T)
n = 12 (5.26%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 10 (4.39%)
Leucine (Leu, L)
n = 29 (12.72%)
Isoleucine (Ile, I)
n = 23 (10.09%)
Methionine (Met, M)
n = 14 (6.14%)
Proline (Pro, P)
n = 12 (5.26%)
Phenylalanine (Phe, F)
n = 10 (4.39%)
Tyrosine (Tyr, Y)
n = 14 (6.14%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 10 (4.39%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 6 (2.63%)
Glutamine (Gln, Q)
n = 8 (3.51%)
Histidine (His, H)
n = 6 (2.63%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 14 9 6 2 11 1 8 8 0 2 0 7 1 3 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 4 6 8 0 0 4 2 2 3 3 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 5 0 2 5 7 0 1 3 5 9 0 1 2 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 13 1 3 7 4 0 1 2 3 0 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
60 52 63 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 56 62 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 77 96 45
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 18 (6.92%)
Serine (Ser, S)
n = 21 (8.08%)
Threonine (Thr, T)
n = 28 (10.77%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 12 (4.62%)
Leucine (Leu, L)
n = 25 (9.62%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 11 (4.23%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 14 (5.38%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 10 9 6 2 11 3 3 9 0 3 2 6 1 7 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 7 4 7 0 2 6 10 2 5 2 4 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 13 1 6 3 7 0 0 5 7 7 0 0 1 3 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 1 1 2 2 0 0 1 3 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 63 66 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 73 56 88
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 85 103 61
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.07%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 39 (10.29%)
Cysteine (Cys, C)
n = 2 (0.53%)
Valine (Val, V)
n = 13 (3.43%)
Leucine (Leu, L)
n = 54 (14.25%)
Isoleucine (Ile, I)
n = 38 (10.03%)
Methionine (Met, M)
n = 13 (3.43%)
Proline (Pro, P)
n = 24 (6.33%)
Phenylalanine (Phe, F)
n = 28 (7.39%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 13 (3.43%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 11 (2.9%)
Arginine (Arg, R)
n = 7 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 24 10 5 9 22 7 10 6 2 1 5 5 2 9 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 8 8 11 0 5 9 8 1 2 10 10 2 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 16 2 3 9 9 1 1 2 5 8 3 1 4 9 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 4 2 2 9 7 4 0 1 6 0 0 0 0 1 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 94 117 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 112 75 146
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
31 149 133 67
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 27 (8.52%)
Serine (Ser, S)
n = 21 (6.62%)
Threonine (Thr, T)
n = 34 (10.73%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 10 (3.15%)
Leucine (Leu, L)
n = 60 (18.93%)
Isoleucine (Ile, I)
n = 24 (7.57%)
Methionine (Met, M)
n = 19 (5.99%)
Proline (Pro, P)
n = 20 (6.31%)
Phenylalanine (Phe, F)
n = 17 (5.36%)
Tyrosine (Tyr, Y)
n = 15 (4.73%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 14 (4.42%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 1 (0.32%)
Lysine (Lys, K)
n = 6 (1.89%)
Arginine (Arg, R)
n = 7 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 14 18 5 13 31 2 9 7 0 3 2 4 1 8 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 2 13 12 0 0 9 2 1 4 7 8 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 15 0 1 6 12 0 0 2 4 11 0 0 5 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 8 3 1 2 5 1 0 1 5 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
63 86 99 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
31 100 57 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 113 145 49
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 18 (5.22%)
Serine (Ser, S)
n = 26 (7.54%)
Threonine (Thr, T)
n = 40 (11.59%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 58 (16.81%)
Isoleucine (Ile, I)
n = 37 (10.72%)
Methionine (Met, M)
n = 35 (10.14%)
Proline (Pro, P)
n = 25 (7.25%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 9 (2.61%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 22 (6.38%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 23 31 7 9 35 1 5 10 0 0 1 4 0 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 0 16 2 0 0 3 6 3 2 10 12 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 26 1 1 8 13 1 2 1 4 5 1 1 3 19 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 0 1 10 1 0 1 1 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 97 148 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 106 64 147
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 120 169 42
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 18 (5.22%)
Serine (Ser, S)
n = 26 (7.54%)
Threonine (Thr, T)
n = 40 (11.59%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 58 (16.81%)
Isoleucine (Ile, I)
n = 37 (10.72%)
Methionine (Met, M)
n = 35 (10.14%)
Proline (Pro, P)
n = 25 (7.25%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 9 (2.61%)
Tryptophan (Trp, W)
n = 11 (3.19%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 22 (6.38%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 11 (3.19%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 23 31 7 9 35 1 5 10 0 0 1 4 0 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 0 16 2 0 0 3 6 3 2 10 12 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 26 1 1 8 13 1 2 1 4 5 1 1 3 19 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 4 0 0 1 10 1 0 1 1 1 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 97 148 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 106 64 147
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 120 169 42
ND4 (size: 1375 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (3.5%)
Alanine (Ala, A)
n = 26 (5.69%)
Serine (Ser, S)
n = 38 (8.32%)
Threonine (Thr, T)
n = 44 (9.63%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 12 (2.63%)
Leucine (Leu, L)
n = 90 (19.69%)
Isoleucine (Ile, I)
n = 35 (7.66%)
Methionine (Met, M)
n = 42 (9.19%)
Proline (Pro, P)
n = 25 (5.47%)
Phenylalanine (Phe, F)
n = 22 (4.81%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 12 (2.63%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 24 (5.25%)
Glutamine (Gln, Q)
n = 8 (1.75%)
Histidine (His, H)
n = 10 (2.19%)
Lysine (Lys, K)
n = 12 (2.63%)
Arginine (Arg, R)
n = 10 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 16 39 9 10 44 9 15 7 1 3 5 4 0 9 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 4 3 15 8 0 3 5 5 3 5 8 11 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 20 1 4 10 12 1 2 9 6 9 2 3 13 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 7 2 0 2 11 1 1 1 8 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 125 168 100
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 122 80 201
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 141 201 89
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 6 (6.12%)
Serine (Ser, S)
n = 6 (6.12%)
Threonine (Thr, T)
n = 8 (8.16%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 25 (25.51%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 10 (10.2%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 6 (6.12%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 4 8 1 1 13 3 6 2 0 0 1 3 1 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 2 3 0 0 3 1 0 1 1 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 0 2 2 2 0 0 0 3 3 0 1 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 25 29 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
8 22 19 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 27 46 19
ND5 (size: 1806 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (4.49%)
Alanine (Ala, A)
n = 39 (6.49%)
Serine (Ser, S)
n = 56 (9.32%)
Threonine (Thr, T)
n = 61 (10.15%)
Cysteine (Cys, C)
n = 3 (0.5%)
Valine (Val, V)
n = 17 (2.83%)
Leucine (Leu, L)
n = 88 (14.64%)
Isoleucine (Ile, I)
n = 56 (9.32%)
Methionine (Met, M)
n = 39 (6.49%)
Proline (Pro, P)
n = 28 (4.66%)
Phenylalanine (Phe, F)
n = 47 (7.82%)
Tyrosine (Tyr, Y)
n = 13 (2.16%)
Tryptophan (Trp, W)
n = 13 (2.16%)
Aspartic acid (Asp, D)
n = 10 (1.66%)
Glutamic acid (Glu, E)
n = 10 (1.66%)
Asparagine (Asn, N)
n = 31 (5.16%)
Glutamine (Gln, Q)
n = 18 (3.0%)
Histidine (His, H)
n = 16 (2.66%)
Lysine (Lys, K)
n = 20 (3.33%)
Arginine (Arg, R)
n = 9 (1.5%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 28 33 15 9 45 4 14 17 1 5 1 10 1 21 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 3 0 4 15 19 1 3 12 7 5 7 6 15 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 28 4 8 10 19 4 3 12 6 7 3 1 7 24 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 2 2 8 16 4 0 4 5 0 0 0 0 1 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
103 144 222 133
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 169 119 247
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 195 246 124
ND6 (size: 534 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.12%)
Alanine (Ala, A)
n = 12 (6.78%)
Serine (Ser, S)
n = 10 (5.65%)
Threonine (Thr, T)
n = 10 (5.65%)
Cysteine (Cys, C)
n = 3 (1.69%)
Valine (Val, V)
n = 18 (10.17%)
Leucine (Leu, L)
n = 19 (10.73%)
Isoleucine (Ile, I)
n = 14 (7.91%)
Methionine (Met, M)
n = 13 (7.34%)
Proline (Pro, P)
n = 6 (3.39%)
Phenylalanine (Phe, F)
n = 12 (6.78%)
Tyrosine (Tyr, Y)
n = 10 (5.65%)
Tryptophan (Trp, W)
n = 4 (2.26%)
Aspartic acid (Asp, D)
n = 5 (2.82%)
Glutamic acid (Glu, E)
n = 7 (3.95%)
Asparagine (Asn, N)
n = 3 (1.69%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 2 (1.13%)
Lysine (Lys, K)
n = 2 (1.13%)
Arginine (Arg, R)
n = 2 (1.13%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 0 5 2 0 1 3 8 0 0 4 1 5 8 9 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 3 0 6 1 3 2 9 2 5 9 5 0 0 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 2 3 3 0 1 2 4 0 10 0 3 5 2 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 4 4 1 2 0 1 0 0 1 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 16 46 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 34 30 76
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
49 10 37 82
Total protein-coding genes (size: 11393 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 204 (5.38%)
Alanine (Ala, A)
n = 254 (6.69%)
Serine (Ser, S)
n = 280 (7.38%)
Threonine (Thr, T)
n = 364 (9.59%)
Cysteine (Cys, C)
n = 24 (0.63%)
Valine (Val, V)
n = 150 (3.95%)
Leucine (Leu, L)
n = 590 (15.55%)
Isoleucine (Ile, I)
n = 329 (8.67%)
Methionine (Met, M)
n = 247 (6.51%)
Proline (Pro, P)
n = 205 (5.4%)
Phenylalanine (Phe, F)
n = 239 (6.3%)
Tyrosine (Tyr, Y)
n = 139 (3.66%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 89 (2.35%)
Asparagine (Asn, N)
n = 159 (4.19%)
Glutamine (Gln, Q)
n = 94 (2.48%)
Histidine (His, H)
n = 98 (2.58%)
Lysine (Lys, K)
n = 92 (2.42%)
Arginine (Arg, R)
n = 62 (1.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
162 167 195 73 77 274 43 107 87 7 28 24 75 23 105 134
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
52 11 13 49 100 101 4 33 71 65 35 44 63 91 7 61
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
122 167 14 42 74 100 11 13 40 62 77 16 16 54 105 33
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
65 69 20 20 46 79 13 3 13 42 4 0 0 3 3 88
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
763 926 1244 862
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
447 1050 743 1555
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
268 1191 1543 793

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.