Viewing data for Addax nasomaculatus


Scientific name Addax nasomaculatus
Common name Addax
Maximum lifespan 28.00 years (Addax nasomaculatus@AnAge)

Total mtDNA (size: 16751 bases) GC AT G C A T
Base content (bases) 6599 10152 4367 2232 4528 5624
Base content per 1 kb (bases) 394 606 261 133 270 336
Base content (%) 39.4% 60.6%
Total protein-coding genes (size: 11338 bases) GC AT G C A T
Base content (bases) 4501 6837 3138 1363 3145 3692
Base content per 1 kb (bases) 397 603 277 120 277 326
Base content (%) 39.7% 60.3%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1512 bases) GC AT G C A T
Base content (bases) 546 966 315 231 430 536
Base content per 1 kb (bases) 361 639 208 153 284 354
Base content (%) 36.1% 63.9%
Total rRNA-coding genes (size: 2526 bases) GC AT G C A T
Base content (bases) 1002 1524 554 448 595 929
Base content per 1 kb (bases) 397 603 219 177 236 368
Base content (%) 39.7% 60.3%
12S rRNA gene (size: 955 bases) GC AT G C A T
Base content (bases) 399 556 224 175 214 342
Base content per 1 kb (bases) 418 582 235 183 224 358
Base content (%) 41.8% 58.2%
16S rRNA gene (size: 1571 bases) GC AT G C A T
Base content (bases) 603 968 330 273 381 587
Base content per 1 kb (bases) 384 616 210 174 243 374
Base content (%) 38.4% 61.6%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 268 413 190 78 196 217
Base content per 1 kb (bases) 394 606 279 115 288 319
Base content (%) 39.4% 60.6%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 66 135 51 15 54 81
Base content per 1 kb (bases) 328 672 254 75 269 403
Base content (%) 32.8% 67.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 639 906 377 262 468 438
Base content per 1 kb (bases) 414 586 244 170 303 283
Base content (%) 41.4% 58.6%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 253 431 159 94 186 245
Base content per 1 kb (bases) 370 630 232 137 272 358
Base content (%) 37.0% 63.0%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 349 435 233 116 221 214
Base content per 1 kb (bases) 445 555 297 148 282 273
Base content (%) 44.5% 55.5%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 488 652 337 151 298 354
Base content per 1 kb (bases) 428 572 296 132 261 311
Base content (%) 42.8% 57.2%
ND1 (size: 956 bases) GC AT G C A T
Base content (bases) 381 575 272 109 264 311
Base content per 1 kb (bases) 399 601 285 114 276 325
Base content (%) 39.9% 60.1%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 362 680 278 84 293 387
Base content per 1 kb (bases) 347 653 267 81 281 371
Base content (%) 34.7% 65.3%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 143 203 104 39 92 111
Base content per 1 kb (bases) 413 587 301 113 266 321
Base content (%) 41.3% 58.7%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 547 831 396 151 395 436
Base content per 1 kb (bases) 397 603 287 110 287 316
Base content (%) 39.7% 60.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 114 183 75 39 93 90
Base content per 1 kb (bases) 384 616 253 131 313 303
Base content (%) 38.4% 61.6%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 716 1105 522 194 499 606
Base content per 1 kb (bases) 393 607 287 107 274 333
Base content (%) 39.3% 60.7%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 195 333 158 37 108 225
Base content per 1 kb (bases) 369 631 299 70 205 426
Base content (%) 36.9% 63.1%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 24 (10.62%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.42%)
Leucine (Leu, L)
n = 44 (19.47%)
Isoleucine (Ile, I)
n = 24 (10.62%)
Methionine (Met, M)
n = 13 (5.75%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 13 (5.75%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 7 10 6 5 20 4 8 9 0 2 3 5 0 7 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 4 8 5 0 1 4 6 0 4 2 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 12 2 2 1 6 0 1 5 0 2 0 1 4 7 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 1 2 1 0 4 0 1 1 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
42 66 82 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 62 37 104
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 62 98 55
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLVLFIIFQMKIAKHNFYYNPELASMGTPKQNTPWETKWTKIYLPLSLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.52%)
Alanine (Ala, A)
n = 2 (3.03%)
Serine (Ser, S)
n = 4 (6.06%)
Threonine (Thr, T)
n = 7 (10.61%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.52%)
Leucine (Leu, L)
n = 10 (15.15%)
Isoleucine (Ile, I)
n = 5 (7.58%)
Methionine (Met, M)
n = 5 (7.58%)
Proline (Pro, P)
n = 6 (9.09%)
Phenylalanine (Phe, F)
n = 4 (6.06%)
Tyrosine (Tyr, Y)
n = 3 (4.55%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 3 (4.55%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 1 (1.52%)
Lysine (Lys, K)
n = 5 (7.58%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 2 4 1 2 4 0 2 2 1 0 1 0 0 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 2 0 0 0 1 0 2 1 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 4 1 0 0 4 0 0 0 1 2 0 1 0 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 0 1 0 5 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
7 17 25 18
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 19 19 25
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 15 37 11
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 41 (7.98%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 37 (7.2%)
Methionine (Met, M)
n = 34 (6.61%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 17 26 8 6 23 6 14 6 0 6 8 18 6 19 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 13 10 16 2 5 13 25 4 11 8 8 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 18 1 12 2 12 1 0 3 10 9 2 2 6 13 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 7 2 7 8 9 0 0 2 5 1 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 102 140 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 134 95 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 141 203 135
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 8 (3.52%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 18 (7.93%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 33 (14.54%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 17 (7.49%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 6 14 2 3 10 5 11 6 0 0 4 6 1 5 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 1 0 2 6 0 0 2 5 1 0 4 9 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 11 0 4 4 7 1 3 2 5 6 0 2 3 2 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 15 0 3 7 3 3 1 0 5 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 52 70 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 52 114 46
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 15 (5.77%)
Serine (Ser, S)
n = 20 (7.69%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 10 (3.85%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 3 (1.15%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 7 (2.69%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 6 7 5 8 10 1 7 7 0 1 7 7 0 12 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 2 3 8 4 0 4 8 6 2 0 7 5 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 11 1 2 2 11 0 3 2 6 5 1 1 1 6 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 6 2 1 2 2 0 0 3 2 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 65 63 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 66 55 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 102 96 52
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 25 (6.6%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 29 (7.65%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 21 (5.54%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 39 (10.29%)
Methionine (Met, M)
n = 14 (3.69%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 25 (6.6%)
Tyrosine (Tyr, Y)
n = 15 (3.96%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 12 (3.17%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 16 (4.22%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 25 13 8 12 25 5 7 6 0 2 9 10 0 12 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 1 9 14 1 0 9 14 1 4 5 13 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 19 1 2 7 10 0 1 3 8 7 0 0 4 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 6 0 0 12 8 1 0 0 8 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
88 98 112 82
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 95 76 156
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 144 166 60
ND1 (size: 956 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.79%)
Alanine (Ala, A)
n = 28 (8.83%)
Serine (Ser, S)
n = 22 (6.94%)
Threonine (Thr, T)
n = 21 (6.62%)
Cysteine (Cys, C)
n = 1 (0.32%)
Valine (Val, V)
n = 13 (4.1%)
Leucine (Leu, L)
n = 54 (17.03%)
Isoleucine (Ile, I)
n = 31 (9.78%)
Methionine (Met, M)
n = 20 (6.31%)
Proline (Pro, P)
n = 22 (6.94%)
Phenylalanine (Phe, F)
n = 21 (6.62%)
Tyrosine (Tyr, Y)
n = 12 (3.79%)
Tryptophan (Trp, W)
n = 9 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.95%)
Glutamic acid (Glu, E)
n = 11 (3.47%)
Asparagine (Asn, N)
n = 13 (4.1%)
Glutamine (Gln, Q)
n = 7 (2.21%)
Histidine (His, H)
n = 3 (0.95%)
Lysine (Lys, K)
n = 7 (2.21%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 17 18 5 8 29 3 9 7 0 2 3 8 0 9 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 4 9 15 0 1 5 4 2 4 8 10 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 13 1 0 6 12 1 1 2 3 9 0 0 3 10 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 11 0 1 2 7 0 1 0 7 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 85 95 71
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 90 56 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 97 159 53
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 21 (6.07%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 53 (15.32%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 17 (4.91%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 14 41 5 9 22 1 16 10 0 0 5 4 0 4 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 11 5 2 0 4 9 1 3 4 10 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 16 1 5 7 15 0 1 1 2 6 0 0 6 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 0 0 13 0 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 72 150 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 103 58 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 103 179 59
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 21 (6.07%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 38 (10.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (2.6%)
Leucine (Leu, L)
n = 53 (15.32%)
Isoleucine (Ile, I)
n = 38 (10.98%)
Methionine (Met, M)
n = 42 (12.14%)
Proline (Pro, P)
n = 17 (4.91%)
Phenylalanine (Phe, F)
n = 15 (4.34%)
Tyrosine (Tyr, Y)
n = 8 (2.31%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 10 (2.89%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 14 41 5 9 22 1 16 10 0 0 5 4 0 4 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 3 11 5 2 0 4 9 1 3 4 10 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 16 1 5 7 15 0 1 1 2 6 0 0 6 11 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 5 0 0 0 13 0 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
49 72 150 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
29 103 58 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 103 179 59
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.71%)
Alanine (Ala, A)
n = 28 (6.11%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 35 (7.64%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 18 (3.93%)
Leucine (Leu, L)
n = 94 (20.52%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 34 (7.42%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 8 (1.75%)
Asparagine (Asn, N)
n = 24 (5.24%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 13 (2.84%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 23 31 11 17 40 9 16 10 1 3 6 9 0 6 15
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 2 7 6 14 1 3 6 7 1 4 10 8 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 18 2 4 15 8 1 3 8 6 8 2 1 8 16 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 8 0 3 1 10 1 2 2 6 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 133 155 96
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 113 85 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 150 196 91
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 7 (7.14%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 12 (12.24%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 8 4 1 12 0 4 2 0 1 0 5 1 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 2 1 2 3 2 0 2 2 0 0 1 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 2 0 2 4 3 0 0 1 2 1 0 1 3 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 1 0 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 24 28 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 23 17 50
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 28 45 18
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 37 (6.11%)
Serine (Ser, S)
n = 50 (8.25%)
Threonine (Thr, T)
n = 58 (9.57%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 16 (2.64%)
Leucine (Leu, L)
n = 89 (14.69%)
Isoleucine (Ile, I)
n = 60 (9.9%)
Methionine (Met, M)
n = 42 (6.93%)
Proline (Pro, P)
n = 26 (4.29%)
Phenylalanine (Phe, F)
n = 46 (7.59%)
Tyrosine (Tyr, Y)
n = 17 (2.81%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 10 (1.65%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 36 (5.94%)
Glutamine (Gln, Q)
n = 18 (2.97%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 35 40 13 14 46 3 9 17 1 3 5 7 1 15 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 4 4 12 21 0 4 10 13 1 5 11 10 0 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 26 2 9 12 14 1 1 13 9 8 3 4 11 25 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 10 2 3 7 20 2 1 5 2 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
103 142 232 130
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
68 157 129 253
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
23 223 245 116
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 6 (3.43%)
Serine (Ser, S)
n = 11 (6.29%)
Threonine (Thr, T)
n = 9 (5.14%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 24 (13.71%)
Leucine (Leu, L)
n = 17 (9.71%)
Isoleucine (Ile, I)
n = 17 (9.71%)
Methionine (Met, M)
n = 10 (5.71%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 14 (8.0%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 2 2 0 0 0 0 10 0 1 11 1 4 8 14 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 1 0 4 0 0 2 10 0 2 14 3 0 0 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 1 1 3 2 2 0 4 0 9 1 1 7 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 8 4 0 1 3 1 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 5 48 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 25 33 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 7 27 89
Total protein-coding genes (size: 11403 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 245 (6.45%)
Serine (Ser, S)
n = 280 (7.37%)
Threonine (Thr, T)
n = 319 (8.4%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 187 (4.92%)
Leucine (Leu, L)
n = 591 (15.56%)
Isoleucine (Ile, I)
n = 334 (8.79%)
Methionine (Met, M)
n = 260 (6.85%)
Proline (Pro, P)
n = 190 (5.0%)
Phenylalanine (Phe, F)
n = 243 (6.4%)
Tyrosine (Tyr, Y)
n = 128 (3.37%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 66 (1.74%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 165 (4.34%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 97 (2.55%)
Lysine (Lys, K)
n = 95 (2.5%)
Arginine (Arg, R)
n = 64 (1.69%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
174 160 219 70 94 255 37 115 84 5 32 53 85 17 109 134
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
41 7 16 47 81 107 10 28 63 97 27 42 62 85 1 48
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
100 157 14 45 63 107 5 20 40 61 67 9 20 54 111 35
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
62 80 16 25 41 85 10 7 14 41 2 1 0 7 0 95
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
809 896 1234 860
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
467 974 743 1615
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
214 1161 1620 804

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.