Viewing data for Cardinalis cardinalis


Scientific name Cardinalis cardinalis
Common name Northern cardinal
Maximum lifespan 28.50 years (Cardinalis cardinalis@AnAge)

Total mtDNA (size: 16779 bases) GC AT G C A T
Base content (bases) 7559 9213 5132 2427 4216 4997
Base content per 1 kb (bases) 451 549 306 145 251 298
Base content (%) 45.1% 54.9%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5200 6171 3720 1480 2897 3274
Base content per 1 kb (bases) 457 542 327 130 255 288
Base content (%) 45.7% 54.2%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1540 bases) GC AT G C A T
Base content (bases) 636 904 368 268 404 500
Base content per 1 kb (bases) 413 587 239 174 262 325
Base content (%) 41.3% 58.7%
Total rRNA-coding genes (size: 2573 bases) GC AT G C A T
Base content (bases) 1179 1394 657 522 548 846
Base content per 1 kb (bases) 458 542 255 203 213 329
Base content (%) 45.8% 54.2%
12S rRNA gene (size: 975 bases) GC AT G C A T
Base content (bases) 474 501 268 206 205 296
Base content per 1 kb (bases) 486 514 275 211 210 304
Base content (%) 48.6% 51.4%
16S rRNA gene (size: 1598 bases) GC AT G C A T
Base content (bases) 705 893 389 316 343 550
Base content per 1 kb (bases) 441 559 243 198 215 344
Base content (%) 44.1% 55.9%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 315 369 239 76 174 195
Base content per 1 kb (bases) 461 539 349 111 254 285
Base content (%) 46.1% 53.9%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 73 95 62 11 48 47
Base content per 1 kb (bases) 435 565 369 65 286 280
Base content (%) 43.5% 56.5%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 701 850 445 256 415 435
Base content per 1 kb (bases) 452 548 287 165 268 280
Base content (%) 45.2% 54.8%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 315 369 209 106 170 199
Base content per 1 kb (bases) 461 539 306 155 249 291
Base content (%) 46.1% 53.9%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 375 407 252 123 202 205
Base content per 1 kb (bases) 478 519 321 157 258 261
Base content (%) 47.8% 51.9%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 523 619 373 150 302 317
Base content per 1 kb (bases) 458 542 326 131 264 277
Base content (%) 45.8% 54.2%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 449 529 294 155 275 254
Base content per 1 kb (bases) 459 541 301 158 281 260
Base content (%) 45.9% 54.1%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 478 562 366 112 259 303
Base content per 1 kb (bases) 460 540 352 108 249 291
Base content (%) 46.0% 54.0%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 157 194 114 43 98 96
Base content per 1 kb (bases) 447 553 325 123 279 274
Base content (%) 44.7% 55.3%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 628 750 481 147 341 409
Base content per 1 kb (bases) 456 544 349 107 247 297
Base content (%) 45.6% 54.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 142 155 100 42 78 77
Base content per 1 kb (bases) 478 522 337 141 263 259
Base content (%) 47.8% 52.2%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 800 1016 590 210 470 546
Base content per 1 kb (bases) 440 559 325 116 259 300
Base content (%) 44.0% 55.9%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 248 269 197 51 70 199
Base content per 1 kb (bases) 478 518 380 98 135 383
Base content (%) 47.8% 51.8%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 10 (4.41%)
Leucine (Leu, L)
n = 62 (27.31%)
Isoleucine (Ile, I)
n = 17 (7.49%)
Methionine (Met, M)
n = 7 (3.08%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 12 (5.29%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 9 (3.96%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 15 5 3 15 32 7 4 7 1 2 2 5 1 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 3 8 2 2 0 4 4 0 3 4 7 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 13 0 6 3 3 0 0 4 1 2 0 1 1 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 2 1 4 0 0 3 2 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
40 88 63 37
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 64 35 108
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 87 97 29
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPNPWFFIMLTSWLTFSLIIQPKLLSFISMNPPSNKPPIAPNTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 5 (9.09%)
Threonine (Thr, T)
n = 6 (10.91%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 11 (20.0%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 0 2 1 3 0 0 1 1 0 0 0 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 0 1 0 0 0 0 0 0 5 4 1 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 0 0 1 1 3 0 0 0 0 0 0 0 0 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 19 21 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
5 23 10 18
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 20 16 15
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 38 (7.36%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 40 (7.75%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 22 (4.26%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 21 16 5 11 40 2 5 8 1 4 15 19 2 9 34
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 14 16 15 1 10 9 23 5 9 4 17 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 20 1 9 5 10 0 0 4 2 15 0 0 3 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 9 1 1 14 9 0 2 0 6 0 0 1 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
158 124 128 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 138 93 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 183 214 100
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 16 (7.05%)
Serine (Ser, S)
n = 20 (8.81%)
Threonine (Thr, T)
n = 15 (6.61%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 20 (8.81%)
Leucine (Leu, L)
n = 30 (13.22%)
Isoleucine (Ile, I)
n = 13 (5.73%)
Methionine (Met, M)
n = 11 (4.85%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 13 (5.73%)
Glutamic acid (Glu, E)
n = 11 (4.85%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 11 8 5 6 14 1 4 6 0 6 9 4 1 2 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 5 5 5 1 2 3 2 1 3 2 5 3 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 6 1 4 5 7 0 0 4 2 5 0 0 2 6 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 10 1 2 11 4 0 0 2 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 60 55 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 60 59 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 89 85 42
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 17 (6.54%)
Threonine (Thr, T)
n = 19 (7.31%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 10 4 3 6 21 1 2 7 1 3 10 4 0 4 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 6 12 5 0 1 4 12 2 5 5 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 10 0 7 3 3 0 0 4 2 9 0 0 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 1 0 4 3 1 1 2 3 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 71 56 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 66 55 96
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 111 94 44
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 30 (7.89%)
Serine (Ser, S)
n = 22 (5.79%)
Threonine (Thr, T)
n = 22 (5.79%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 20 (5.26%)
Leucine (Leu, L)
n = 62 (16.32%)
Isoleucine (Ile, I)
n = 38 (10.0%)
Methionine (Met, M)
n = 7 (1.84%)
Proline (Pro, P)
n = 23 (6.05%)
Phenylalanine (Phe, F)
n = 30 (7.89%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 8 (2.11%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 23 6 4 19 29 5 5 6 2 3 7 9 1 7 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 8 16 5 1 2 9 11 2 3 6 14 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 11 0 3 8 10 0 0 1 0 12 0 0 6 15 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 7 0 0 8 10 0 2 2 4 0 0 0 0 1 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
89 108 99 84
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 96 79 157
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 169 138 60
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 31 (9.54%)
Serine (Ser, S)
n = 25 (7.69%)
Threonine (Thr, T)
n = 18 (5.54%)
Cysteine (Cys, C)
n = 3 (0.92%)
Valine (Val, V)
n = 17 (5.23%)
Leucine (Leu, L)
n = 66 (20.31%)
Isoleucine (Ile, I)
n = 22 (6.77%)
Methionine (Met, M)
n = 11 (3.38%)
Proline (Pro, P)
n = 24 (7.38%)
Phenylalanine (Phe, F)
n = 19 (5.85%)
Tyrosine (Tyr, Y)
n = 16 (4.92%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 5 (1.54%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 12 (3.69%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 12 5 3 14 26 12 10 5 1 5 4 8 0 7 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 2 5 11 14 1 4 6 1 3 9 3 11 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 10 0 5 6 7 1 0 6 5 11 4 1 2 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 4 1 4 5 2 3 0 5 0 0 1 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 95 77 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 92 59 135
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 107 118 64
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 32 (9.28%)
Serine (Ser, S)
n = 24 (6.96%)
Threonine (Thr, T)
n = 47 (13.62%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 34 (9.86%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 13 (3.77%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 26 11 13 18 22 9 4 8 2 0 5 3 0 0 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 6 12 14 0 1 5 5 1 4 8 8 1 18
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 12 0 9 6 5 0 0 4 0 7 1 0 5 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 0 1 1 10 3 1 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 106 127 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 120 58 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 140 117 67
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.48%)
Alanine (Ala, A)
n = 32 (9.28%)
Serine (Ser, S)
n = 24 (6.96%)
Threonine (Thr, T)
n = 47 (13.62%)
Cysteine (Cys, C)
n = 2 (0.58%)
Valine (Val, V)
n = 8 (2.32%)
Leucine (Leu, L)
n = 66 (19.13%)
Isoleucine (Ile, I)
n = 34 (9.86%)
Methionine (Met, M)
n = 16 (4.64%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 13 (3.77%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 26 11 13 18 22 9 4 8 2 0 5 3 0 0 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 6 12 14 0 1 5 5 1 4 8 8 1 18
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 12 0 9 6 5 0 0 4 0 7 1 0 5 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 0 1 1 10 3 1 1 2 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 106 127 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 120 58 136
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 140 117 67
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (3.49%)
Alanine (Ala, A)
n = 40 (8.73%)
Serine (Ser, S)
n = 40 (8.73%)
Threonine (Thr, T)
n = 41 (8.95%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 9 (1.97%)
Leucine (Leu, L)
n = 97 (21.18%)
Isoleucine (Ile, I)
n = 43 (9.39%)
Methionine (Met, M)
n = 27 (5.9%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 13 (2.84%)
Tyrosine (Tyr, Y)
n = 14 (3.06%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 13 (2.84%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 12 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 31 21 10 30 39 3 13 13 0 1 1 7 0 3 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 3 3 28 9 0 1 8 7 0 9 11 7 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 16 1 8 8 11 2 3 8 4 10 0 2 3 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 2 1 1 10 0 0 3 9 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 148 148 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 137 79 189
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 196 182 65
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 6 (6.12%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 4 6 1 1 11 4 2 2 1 0 1 0 1 3 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 3 1 7 0 1 0 2 1 1 0 2 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 3 3 4 0 2 2 0 3 0 0 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 1 1 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 30 26 25
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 28 18 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 42 33 14
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (5.29%)
Alanine (Ala, A)
n = 49 (8.1%)
Serine (Ser, S)
n = 53 (8.76%)
Threonine (Thr, T)
n = 68 (11.24%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 17 (2.81%)
Leucine (Leu, L)
n = 103 (17.02%)
Isoleucine (Ile, I)
n = 53 (8.76%)
Methionine (Met, M)
n = 27 (4.46%)
Proline (Pro, P)
n = 30 (4.96%)
Phenylalanine (Phe, F)
n = 38 (6.28%)
Tyrosine (Tyr, Y)
n = 15 (2.48%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 9 (1.49%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 27 (4.46%)
Glutamine (Gln, Q)
n = 17 (2.81%)
Histidine (His, H)
n = 9 (1.49%)
Lysine (Lys, K)
n = 19 (3.14%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 37 24 10 33 42 4 14 14 3 5 4 6 2 4 34
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 4 13 18 18 0 1 8 21 2 9 12 8 0 19
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
27 21 1 7 20 12 0 5 9 3 12 0 0 10 17 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 1 2 7 18 1 1 1 5 1 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
119 152 209 124
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 185 108 238
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 251 227 108
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 32 (18.6%)
Alanine (Ala, A)
n = 12 (6.98%)
Serine (Ser, S)
n = 14 (8.14%)
Threonine (Thr, T)
n = 3 (1.74%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 33 (19.19%)
Leucine (Leu, L)
n = 28 (16.28%)
Isoleucine (Ile, I)
n = 3 (1.74%)
Methionine (Met, M)
n = 6 (3.49%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 10 (5.81%)
Tyrosine (Tyr, Y)
n = 7 (4.07%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 3 (1.74%)
Glutamic acid (Glu, E)
n = 4 (2.33%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 0 2 2 0 1 4 10 0 0 15 0 4 14 8 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 4 0 3 5 7 1 7 16 2 1 0 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 4 1 2 3 4 0 6 1 3 11 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 1 3 0 0 0 0 0 1 3 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 15 18 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 29 17 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
67 7 34 63
Total protein-coding genes (size: 11395 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 221 (5.82%)
Alanine (Ala, A)
n = 313 (8.25%)
Serine (Ser, S)
n = 286 (7.53%)
Threonine (Thr, T)
n = 314 (8.27%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 195 (5.14%)
Leucine (Leu, L)
n = 664 (17.49%)
Isoleucine (Ile, I)
n = 298 (7.85%)
Methionine (Met, M)
n = 157 (4.14%)
Proline (Pro, P)
n = 220 (5.8%)
Phenylalanine (Phe, F)
n = 226 (5.95%)
Tyrosine (Tyr, Y)
n = 114 (3.0%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 68 (1.79%)
Glutamic acid (Glu, E)
n = 89 (2.34%)
Asparagine (Asn, N)
n = 136 (3.58%)
Glutamine (Gln, Q)
n = 94 (2.48%)
Histidine (His, H)
n = 98 (2.58%)
Lysine (Lys, K)
n = 83 (2.19%)
Arginine (Arg, R)
n = 73 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
99 199 113 66 162 293 53 75 81 13 44 58 70 23 54 172
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
44 5 24 68 141 92 12 29 59 99 33 63 63 83 8 80
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
107 122 5 69 70 80 6 14 47 25 89 8 15 34 102 16
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
82 75 14 13 55 76 7 10 15 44 4 1 2 5 2 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
885 1056 1052 797
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
492 1069 689 1540
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
249 1445 1407 689

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.