Viewing data for Blanus cinereus


Scientific name Blanus cinereus
Common name Spanish grey amphisbaena
Maximum lifespan 16.00 years (Blanus cinereus@AnAge)

Total mtDNA (size: 16969 bases) GC AT G C A T
Base content (bases) 7521 9448 5123 2398 3976 5472
Base content per 1 kb (bases) 443 557 302 141 234 322
Base content (%) 44.3% 55.7%
Total protein-coding genes (size: 11354 bases) GC AT G C A T
Base content (bases) 5002 6352 3565 1437 2716 3636
Base content per 1 kb (bases) 441 559 314 127 239 320
Base content (%) 44.1% 55.9%
D-loop (size: 1170 bases) GC AT G C A T
Base content (bases) 470 700 308 162 330 370
Base content per 1 kb (bases) 402 598 263 138 282 316
Base content (%) 40.2% 59.8%
Total tRNA-coding genes (size: 1501 bases) GC AT G C A T
Base content (bases) 691 810 413 278 347 463
Base content per 1 kb (bases) 460 540 275 185 231 308
Base content (%) 46.0% 54.0%
Total rRNA-coding genes (size: 2468 bases) GC AT G C A T
Base content (bases) 1132 1336 684 448 494 842
Base content per 1 kb (bases) 459 541 277 182 200 341
Base content (%) 45.9% 54.1%
12S rRNA gene (size: 955 bases) GC AT G C A T
Base content (bases) 484 471 296 188 174 297
Base content per 1 kb (bases) 507 493 310 197 182 311
Base content (%) 50.7% 49.3%
16S rRNA gene (size: 1513 bases) GC AT G C A T
Base content (bases) 648 865 388 260 320 545
Base content per 1 kb (bases) 428 572 256 172 212 360
Base content (%) 42.8% 57.2%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 294 387 214 80 179 208
Base content per 1 kb (bases) 432 568 314 117 263 305
Base content (%) 43.2% 56.8%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 69 96 50 19 41 55
Base content per 1 kb (bases) 418 582 303 115 248 333
Base content (%) 41.8% 58.2%
COX1 (size: 1536 bases) GC AT G C A T
Base content (bases) 709 827 448 261 394 433
Base content per 1 kb (bases) 462 538 292 170 257 282
Base content (%) 46.2% 53.8%
COX2 (size: 685 bases) GC AT G C A T
Base content (bases) 305 380 209 96 154 226
Base content per 1 kb (bases) 445 555 305 140 225 330
Base content (%) 44.5% 55.5%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 358 426 235 123 207 219
Base content per 1 kb (bases) 457 543 300 157 264 279
Base content (%) 45.7% 54.3%
CYTB (size: 1154 bases) GC AT G C A T
Base content (bases) 504 650 359 145 300 350
Base content per 1 kb (bases) 437 563 311 126 260 303
Base content (%) 43.7% 56.3%
ND1 (size: 966 bases) GC AT G C A T
Base content (bases) 422 544 301 121 232 312
Base content per 1 kb (bases) 437 563 312 125 240 323
Base content (%) 43.7% 56.3%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 456 584 343 113 219 365
Base content per 1 kb (bases) 438 562 330 109 211 351
Base content (%) 43.8% 56.2%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 161 185 106 55 94 91
Base content per 1 kb (bases) 465 535 306 159 272 263
Base content (%) 46.5% 53.5%
ND4 (size: 1374 bases) GC AT G C A T
Base content (bases) 593 781 459 134 333 448
Base content per 1 kb (bases) 432 568 334 98 242 326
Base content (%) 43.2% 56.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 125 172 88 37 78 94
Base content per 1 kb (bases) 421 579 296 125 263 316
Base content (%) 42.1% 57.9%
ND5 (size: 1809 bases) GC AT G C A T
Base content (bases) 769 1040 570 199 426 614
Base content per 1 kb (bases) 425 575 315 110 235 339
Base content (%) 42.5% 57.5%
ND6 (size: 540 bases) GC AT G C A T
Base content (bases) 242 298 186 56 67 231
Base content per 1 kb (bases) 448 552 344 104 124 428
Base content (%) 44.8% 55.2%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 16 (7.08%)
Serine (Ser, S)
n = 12 (5.31%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 12 (5.31%)
Leucine (Leu, L)
n = 53 (23.45%)
Isoleucine (Ile, I)
n = 16 (7.08%)
Methionine (Met, M)
n = 15 (6.64%)
Proline (Pro, P)
n = 19 (8.41%)
Phenylalanine (Phe, F)
n = 9 (3.98%)
Tyrosine (Tyr, Y)
n = 4 (1.77%)
Tryptophan (Trp, W)
n = 2 (0.88%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 9 (3.98%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 2 (0.88%)
Arginine (Arg, R)
n = 5 (2.21%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 11 10 7 12 23 4 7 8 1 2 3 7 0 9 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 0 2 6 8 0 3 3 5 0 3 2 11 3 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 10 0 0 2 5 0 0 5 1 3 0 0 3 6 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 0 1 1 1 2 2 0 0 0 1 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
43 82 72 30
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 67 32 105
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 65 104 44
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPAPWFILLLLVWTTLLVYVTKTTNIMVSLTPALPHAAASRGTFWPWPWL*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.85%)
Alanine (Ala, A)
n = 5 (9.26%)
Serine (Ser, S)
n = 2 (3.7%)
Threonine (Thr, T)
n = 7 (12.96%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 4 (7.41%)
Leucine (Leu, L)
n = 10 (18.52%)
Isoleucine (Ile, I)
n = 2 (3.7%)
Methionine (Met, M)
n = 2 (3.7%)
Proline (Pro, P)
n = 7 (12.96%)
Phenylalanine (Phe, F)
n = 2 (3.7%)
Tyrosine (Tyr, Y)
n = 1 (1.85%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 2 (3.7%)
Glutamine (Gln, Q)
n = 1 (1.85%)
Histidine (His, H)
n = 1 (1.85%)
Lysine (Lys, K)
n = 1 (1.85%)
Arginine (Arg, R)
n = 1 (1.85%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 1 3 1 5 0 1 0 1 0 0 4 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 1 4 0 0 0 1 0 1 1 5 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 5 0 1 0 1 0 0 0 0 1 0 0 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 0 1 0 0 1 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
10 19 14 12
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 21 7 20
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 10 34 9
COX1 (size: 1536 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 48 (9.39%)
Alanine (Ala, A)
n = 44 (8.61%)
Serine (Ser, S)
n = 26 (5.09%)
Threonine (Thr, T)
n = 41 (8.02%)
Cysteine (Cys, C)
n = 2 (0.39%)
Valine (Val, V)
n = 31 (6.07%)
Leucine (Leu, L)
n = 58 (11.35%)
Isoleucine (Ile, I)
n = 41 (8.02%)
Methionine (Met, M)
n = 34 (6.65%)
Proline (Pro, P)
n = 28 (5.48%)
Phenylalanine (Phe, F)
n = 40 (7.83%)
Tyrosine (Tyr, Y)
n = 19 (3.72%)
Tryptophan (Trp, W)
n = 17 (3.33%)
Aspartic acid (Asp, D)
n = 15 (2.94%)
Glutamic acid (Glu, E)
n = 9 (1.76%)
Asparagine (Asn, N)
n = 15 (2.94%)
Glutamine (Gln, Q)
n = 8 (1.57%)
Histidine (His, H)
n = 18 (3.52%)
Lysine (Lys, K)
n = 9 (1.76%)
Arginine (Arg, R)
n = 8 (1.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
16 25 26 6 10 24 8 7 7 1 1 15 13 2 20 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 2 4 19 20 1 5 29 12 2 2 5 19 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
18 16 3 1 4 16 2 0 3 7 12 1 3 2 13 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 7 2 3 12 8 1 1 3 4 0 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
147 110 143 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 136 94 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 202 196 78
COX2 (size: 685 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 17 (7.49%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 10 (4.41%)
Leucine (Leu, L)
n = 29 (12.78%)
Isoleucine (Ile, I)
n = 23 (10.13%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 14 (6.17%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 10 (4.41%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 8 (3.52%)
Glutamic acid (Glu, E)
n = 12 (5.29%)
Asparagine (Asn, N)
n = 7 (3.08%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 11 (4.85%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 16 10 5 7 8 3 6 5 2 1 1 6 2 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 0 1 3 11 0 0 7 1 0 3 0 10 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 8 1 1 2 5 3 2 4 1 9 1 0 2 5 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 2 2 6 5 0 0 3 2 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
53 60 75 40
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 62 60 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 87 91 33
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (8.08%)
Alanine (Ala, A)
n = 18 (6.92%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 30 (11.54%)
Isoleucine (Ile, I)
n = 23 (8.85%)
Methionine (Met, M)
n = 8 (3.08%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 3 (1.15%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 14 (5.38%)
Lysine (Lys, K)
n = 3 (1.15%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 9 5 3 9 14 1 2 7 1 3 4 9 1 10 13
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 1 9 8 0 2 14 4 1 2 2 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 16 1 1 5 4 1 1 3 3 7 0 1 0 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 8 0 0 4 3 0 1 1 3 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 67 66 60
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 66 50 101
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 102 103 45
CYTB (size: 1154 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.27%)
Alanine (Ala, A)
n = 26 (6.79%)
Serine (Ser, S)
n = 22 (5.74%)
Threonine (Thr, T)
n = 33 (8.62%)
Cysteine (Cys, C)
n = 1 (0.26%)
Valine (Val, V)
n = 17 (4.44%)
Leucine (Leu, L)
n = 59 (15.4%)
Isoleucine (Ile, I)
n = 41 (10.7%)
Methionine (Met, M)
n = 16 (4.18%)
Proline (Pro, P)
n = 23 (6.01%)
Phenylalanine (Phe, F)
n = 28 (7.31%)
Tyrosine (Tyr, Y)
n = 14 (3.66%)
Tryptophan (Trp, W)
n = 11 (2.87%)
Aspartic acid (Asp, D)
n = 7 (1.83%)
Glutamic acid (Glu, E)
n = 6 (1.57%)
Asparagine (Asn, N)
n = 17 (4.44%)
Glutamine (Gln, Q)
n = 8 (2.09%)
Histidine (His, H)
n = 15 (3.92%)
Lysine (Lys, K)
n = 8 (2.09%)
Arginine (Arg, R)
n = 8 (2.09%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 27 13 6 11 26 4 12 8 0 3 4 10 0 6 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 2 10 13 1 2 12 7 3 1 3 17 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 18 1 2 8 9 1 0 2 1 13 2 0 4 13 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 0 3 4 7 1 0 5 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
80 101 117 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
46 102 75 161
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 156 158 52
ND1 (size: 966 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.98%)
Alanine (Ala, A)
n = 27 (8.41%)
Serine (Ser, S)
n = 21 (6.54%)
Threonine (Thr, T)
n = 34 (10.59%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 13 (4.05%)
Leucine (Leu, L)
n = 62 (19.31%)
Isoleucine (Ile, I)
n = 16 (4.98%)
Methionine (Met, M)
n = 22 (6.85%)
Proline (Pro, P)
n = 22 (6.85%)
Phenylalanine (Phe, F)
n = 15 (4.67%)
Tyrosine (Tyr, Y)
n = 11 (3.43%)
Tryptophan (Trp, W)
n = 8 (2.49%)
Aspartic acid (Asp, D)
n = 4 (1.25%)
Glutamic acid (Glu, E)
n = 9 (2.8%)
Asparagine (Asn, N)
n = 13 (4.05%)
Glutamine (Gln, Q)
n = 8 (2.49%)
Histidine (His, H)
n = 4 (1.25%)
Lysine (Lys, K)
n = 7 (2.18%)
Arginine (Arg, R)
n = 8 (2.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 8 19 8 15 25 3 11 8 0 2 4 7 0 6 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 2 8 17 0 0 10 3 3 3 1 18 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 21 1 2 9 6 0 0 4 2 9 2 0 3 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 8 1 0 4 7 0 1 3 3 1 0 0 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
69 93 96 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 100 57 128
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 108 159 40
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 37 (10.72%)
Serine (Ser, S)
n = 21 (6.09%)
Threonine (Thr, T)
n = 66 (19.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 64 (18.55%)
Isoleucine (Ile, I)
n = 26 (7.54%)
Methionine (Met, M)
n = 22 (6.38%)
Proline (Pro, P)
n = 15 (4.35%)
Phenylalanine (Phe, F)
n = 9 (2.61%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 12 (3.48%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 8 (2.32%)
Glutamine (Gln, Q)
n = 11 (3.19%)
Histidine (His, H)
n = 6 (1.74%)
Lysine (Lys, K)
n = 12 (3.48%)
Arginine (Arg, R)
n = 5 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 14 19 7 15 31 3 8 11 0 2 2 1 0 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 17 19 0 0 8 3 2 1 4 8 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 36 1 1 3 11 2 0 4 2 5 0 0 4 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 0 0 3 10 2 0 1 2 2 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 93 138 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 135 51 126
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 115 175 39
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 37 (10.72%)
Serine (Ser, S)
n = 21 (6.09%)
Threonine (Thr, T)
n = 66 (19.13%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 5 (1.45%)
Leucine (Leu, L)
n = 64 (18.55%)
Isoleucine (Ile, I)
n = 26 (7.54%)
Methionine (Met, M)
n = 22 (6.38%)
Proline (Pro, P)
n = 15 (4.35%)
Phenylalanine (Phe, F)
n = 9 (2.61%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 12 (3.48%)
Aspartic acid (Asp, D)
n = 3 (0.87%)
Glutamic acid (Glu, E)
n = 4 (1.16%)
Asparagine (Asn, N)
n = 8 (2.32%)
Glutamine (Gln, Q)
n = 11 (3.19%)
Histidine (His, H)
n = 6 (1.74%)
Lysine (Lys, K)
n = 12 (3.48%)
Arginine (Arg, R)
n = 5 (1.45%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 14 19 7 15 31 3 8 11 0 2 2 1 0 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 1 17 19 0 0 8 3 2 1 4 8 2 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 36 1 1 3 11 2 0 4 2 5 0 0 4 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 4 0 0 3 10 2 0 1 2 2 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 93 138 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 135 51 126
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
17 115 175 39
ND4 (size: 1374 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (3.72%)
Alanine (Ala, A)
n = 37 (8.1%)
Serine (Ser, S)
n = 28 (6.13%)
Threonine (Thr, T)
n = 62 (13.57%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 7 (1.53%)
Leucine (Leu, L)
n = 92 (20.13%)
Isoleucine (Ile, I)
n = 46 (10.07%)
Methionine (Met, M)
n = 26 (5.69%)
Proline (Pro, P)
n = 26 (5.69%)
Phenylalanine (Phe, F)
n = 11 (2.41%)
Tyrosine (Tyr, Y)
n = 16 (3.5%)
Tryptophan (Trp, W)
n = 11 (2.41%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.19%)
Asparagine (Asn, N)
n = 14 (3.06%)
Glutamine (Gln, Q)
n = 11 (2.41%)
Histidine (His, H)
n = 16 (3.5%)
Lysine (Lys, K)
n = 11 (2.41%)
Arginine (Arg, R)
n = 9 (1.97%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
24 22 24 17 22 42 1 9 11 0 1 2 3 1 3 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 4 3 21 13 0 2 11 3 1 2 4 20 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 30 0 2 2 17 1 0 6 7 9 4 1 2 12 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 9 1 0 2 11 0 1 5 3 0 0 0 0 1 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 144 165 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 147 81 182
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 168 202 75
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 4 (4.08%)
Threonine (Thr, T)
n = 15 (15.31%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 7 (7.14%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 4 (4.08%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 1 (1.02%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 3 7 1 4 5 0 8 1 0 0 0 2 1 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 0 3 6 0 0 3 1 0 0 0 3 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 5 1 0 1 0 2 0 1 0 1 0 0 2 3 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 1 1 0 1 0 0 1 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
19 22 37 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 31 16 42
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
8 35 41 15
ND5 (size: 1809 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.15%)
Alanine (Ala, A)
n = 49 (8.14%)
Serine (Ser, S)
n = 40 (6.64%)
Threonine (Thr, T)
n = 87 (14.45%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 13 (2.16%)
Leucine (Leu, L)
n = 96 (15.95%)
Isoleucine (Ile, I)
n = 54 (8.97%)
Methionine (Met, M)
n = 37 (6.15%)
Proline (Pro, P)
n = 22 (3.65%)
Phenylalanine (Phe, F)
n = 33 (5.48%)
Tyrosine (Tyr, Y)
n = 8 (1.33%)
Tryptophan (Trp, W)
n = 13 (2.16%)
Aspartic acid (Asp, D)
n = 11 (1.83%)
Glutamic acid (Glu, E)
n = 10 (1.66%)
Asparagine (Asn, N)
n = 26 (4.32%)
Glutamine (Gln, Q)
n = 24 (3.99%)
Histidine (His, H)
n = 18 (2.99%)
Lysine (Lys, K)
n = 21 (3.49%)
Arginine (Arg, R)
n = 10 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 26 31 12 23 41 6 13 20 4 0 5 8 0 10 23
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 4 9 20 20 0 4 15 5 1 1 6 14 1 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
30 44 6 0 8 22 2 1 7 3 5 2 1 4 22 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 1 0 11 21 0 1 7 2 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
108 156 233 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
61 190 119 233
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 224 262 87
ND6 (size: 540 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (13.97%)
Alanine (Ala, A)
n = 13 (7.26%)
Serine (Ser, S)
n = 9 (5.03%)
Threonine (Thr, T)
n = 3 (1.68%)
Cysteine (Cys, C)
n = 8 (4.47%)
Valine (Val, V)
n = 31 (17.32%)
Leucine (Leu, L)
n = 28 (15.64%)
Isoleucine (Ile, I)
n = 10 (5.59%)
Methionine (Met, M)
n = 3 (1.68%)
Proline (Pro, P)
n = 4 (2.23%)
Phenylalanine (Phe, F)
n = 14 (7.82%)
Tyrosine (Tyr, Y)
n = 9 (5.03%)
Tryptophan (Trp, W)
n = 3 (1.68%)
Aspartic acid (Asp, D)
n = 5 (2.79%)
Glutamic acid (Glu, E)
n = 2 (1.12%)
Asparagine (Asn, N)
n = 1 (0.56%)
Glutamine (Gln, Q)
n = 3 (1.68%)
Histidine (His, H)
n = 2 (1.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 6 (3.35%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 1 0 5 0 2 3 5 0 3 13 0 5 13 14 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 6 2 4 1 3 5 12 1 2 10 0 0 0 4 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 2 2 0 2 1 4 0 8 1 2 13 1 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 1 5 0 0 0 2 0 1 3 1 0 0 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 25 22 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 25 22 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
63 6 23 88
Total protein-coding genes (size: 11377 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 219 (5.78%)
Alanine (Ala, A)
n = 308 (8.13%)
Serine (Ser, S)
n = 225 (5.94%)
Threonine (Thr, T)
n = 428 (11.3%)
Cysteine (Cys, C)
n = 29 (0.77%)
Valine (Val, V)
n = 166 (4.38%)
Leucine (Leu, L)
n = 623 (16.44%)
Isoleucine (Ile, I)
n = 316 (8.34%)
Methionine (Met, M)
n = 212 (5.6%)
Proline (Pro, P)
n = 205 (5.41%)
Phenylalanine (Phe, F)
n = 202 (5.33%)
Tyrosine (Tyr, Y)
n = 112 (2.96%)
Tryptophan (Trp, W)
n = 103 (2.72%)
Aspartic acid (Asp, D)
n = 63 (1.66%)
Glutamic acid (Glu, E)
n = 82 (2.16%)
Asparagine (Asn, N)
n = 120 (3.17%)
Glutamine (Gln, Q)
n = 101 (2.67%)
Histidine (His, H)
n = 113 (2.98%)
Lysine (Lys, K)
n = 80 (2.11%)
Arginine (Arg, R)
n = 75 (1.98%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
146 170 170 88 134 252 38 92 88 13 28 41 77 20 90 112
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
42 10 19 31 122 148 7 30 116 49 24 19 32 138 16 47
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
149 215 17 13 45 101 16 8 42 35 77 16 19 28 92 28
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
85 72 10 14 49 75 5 10 31 26 8 1 0 5 2 87
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
838 1006 1207 739
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
477 1116 678 1519
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
253 1316 1596 625

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.