Viewing data for Boselaphus tragocamelus


Scientific name Boselaphus tragocamelus
Common name Nilgai
Maximum lifespan 21.70 years (Boselaphus tragocamelus@AnAge)

Total mtDNA (size: 16322 bases) GC AT G C A T
Base content (bases) 6396 9926 4253 2143 4397 5529
Base content per 1 kb (bases) 392 608 261 131 269 339
Base content (%) 39.2% 60.8%
Total protein-coding genes (size: 11336 bases) GC AT G C A T
Base content (bases) 4486 6850 3147 1339 3111 3739
Base content per 1 kb (bases) 396 604 278 118 274 330
Base content (%) 39.6% 60.4%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1513 bases) GC AT G C A T
Base content (bases) 545 968 318 227 427 541
Base content per 1 kb (bases) 360 640 210 150 282 358
Base content (%) 36.0% 64.0%
Total rRNA-coding genes (size: 2530 bases) GC AT G C A T
Base content (bases) 977 1553 547 430 590 963
Base content per 1 kb (bases) 386 614 216 170 233 381
Base content (%) 38.6% 61.4%
12S rRNA gene (size: 956 bases) GC AT G C A T
Base content (bases) 375 581 209 166 229 352
Base content per 1 kb (bases) 392 608 219 174 240 368
Base content (%) 39.2% 60.8%
16S rRNA gene (size: 1574 bases) GC AT G C A T
Base content (bases) 602 972 338 264 361 611
Base content per 1 kb (bases) 382 618 215 168 229 388
Base content (%) 38.2% 61.8%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 275 406 201 74 189 217
Base content per 1 kb (bases) 404 596 295 109 278 319
Base content (%) 40.4% 59.6%
ATP8 (size: 201 bases) GC AT G C A T
Base content (bases) 66 135 54 12 53 82
Base content per 1 kb (bases) 328 672 269 60 264 408
Base content (%) 32.8% 67.2%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 623 922 377 246 462 460
Base content per 1 kb (bases) 403 597 244 159 299 298
Base content (%) 40.3% 59.7%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 266 418 174 92 179 239
Base content per 1 kb (bases) 389 611 254 135 262 349
Base content (%) 38.9% 61.1%
COX3 (size: 781 bases) GC AT G C A T
Base content (bases) 342 439 225 117 227 212
Base content per 1 kb (bases) 438 562 288 150 291 271
Base content (%) 43.8% 56.2%
CYTB (size: 1140 bases) GC AT G C A T
Base content (bases) 476 664 326 150 297 367
Base content per 1 kb (bases) 418 582 286 132 261 322
Base content (%) 41.8% 58.2%
ND1 (size: 957 bases) GC AT G C A T
Base content (bases) 390 567 277 113 254 313
Base content per 1 kb (bases) 408 592 289 118 265 327
Base content (%) 40.8% 59.2%
ND2 (size: 1042 bases) GC AT G C A T
Base content (bases) 377 665 285 92 286 379
Base content per 1 kb (bases) 362 638 274 88 274 364
Base content (%) 36.2% 63.8%
ND3 (size: 346 bases) GC AT G C A T
Base content (bases) 140 206 102 38 95 111
Base content per 1 kb (bases) 405 595 295 110 275 321
Base content (%) 40.5% 59.5%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 537 841 387 150 393 448
Base content per 1 kb (bases) 390 610 281 109 285 325
Base content (%) 39.0% 61.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 110 187 73 37 94 93
Base content per 1 kb (bases) 370 630 246 125 316 313
Base content (%) 37.0% 63.0%
ND5 (size: 1821 bases) GC AT G C A T
Base content (bases) 723 1098 533 190 486 612
Base content per 1 kb (bases) 397 603 293 104 267 336
Base content (%) 39.7% 60.3%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 181 347 146 35 119 228
Base content per 1 kb (bases) 343 657 277 66 225 432
Base content (%) 34.3% 65.7%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 17 (7.52%)
Serine (Ser, S)
n = 15 (6.64%)
Threonine (Thr, T)
n = 25 (11.06%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.98%)
Leucine (Leu, L)
n = 45 (19.91%)
Isoleucine (Ile, I)
n = 26 (11.5%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 12 (5.31%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 2 (0.88%)
Tryptophan (Trp, W)
n = 3 (1.33%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 3 (1.33%)
Asparagine (Asn, N)
n = 11 (4.87%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 6 (2.65%)
Lysine (Lys, K)
n = 4 (1.77%)
Arginine (Arg, R)
n = 4 (1.77%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 11 10 7 5 22 3 7 9 0 0 4 5 0 5 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 4 9 4 0 1 4 5 1 2 4 5 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 15 0 2 3 3 1 2 4 0 2 0 1 4 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 0 1 4 0 0 2 2 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
41 68 83 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
24 63 37 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 70 97 51
ATP8 (size: 201 bases)
Amino acid sequence: MPQLDTSTWLTMILSMFLTLFIMFQLKISKHNFYHNPELSLTKTPKQTTPWETKWTKIYLPLSLPL*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 5 (7.58%)
Threonine (Thr, T)
n = 10 (15.15%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 12 (18.18%)
Isoleucine (Ile, I)
n = 4 (6.06%)
Methionine (Met, M)
n = 4 (6.06%)
Proline (Pro, P)
n = 6 (9.09%)
Phenylalanine (Phe, F)
n = 4 (6.06%)
Tyrosine (Tyr, Y)
n = 2 (3.03%)
Tryptophan (Trp, W)
n = 3 (4.55%)
Aspartic acid (Asp, D)
n = 1 (1.52%)
Glutamic acid (Glu, E)
n = 2 (3.03%)
Asparagine (Asn, N)
n = 2 (3.03%)
Glutamine (Gln, Q)
n = 3 (4.55%)
Histidine (His, H)
n = 2 (3.03%)
Lysine (Lys, K)
n = 6 (9.09%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 3 3 1 1 5 1 2 3 0 0 0 0 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 0 0 0 0 0 0 2 1 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 5 1 0 0 5 0 0 0 2 0 0 2 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 1 1 1 0 6 0 0 0 0 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 19 26 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
3 21 19 24
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 14 37 10
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.14%)
Alanine (Ala, A)
n = 40 (7.78%)
Serine (Ser, S)
n = 30 (5.84%)
Threonine (Thr, T)
n = 38 (7.39%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 38 (7.39%)
Leucine (Leu, L)
n = 59 (11.48%)
Isoleucine (Ile, I)
n = 37 (7.2%)
Methionine (Met, M)
n = 34 (6.61%)
Proline (Pro, P)
n = 28 (5.45%)
Phenylalanine (Phe, F)
n = 42 (8.17%)
Tyrosine (Tyr, Y)
n = 19 (3.7%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 15 (2.92%)
Glutamic acid (Glu, E)
n = 10 (1.95%)
Asparagine (Asn, N)
n = 19 (3.7%)
Glutamine (Gln, Q)
n = 6 (1.17%)
Histidine (His, H)
n = 17 (3.31%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 8 (1.56%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
27 10 31 8 6 26 3 14 6 0 4 13 19 2 18 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 1 0 5 17 16 2 7 9 24 7 11 6 11 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 21 0 8 5 14 0 2 1 8 11 1 2 9 10 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 0 6 9 9 0 1 1 6 0 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
150 102 140 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
76 133 96 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 142 224 129
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 7 (3.08%)
Serine (Ser, S)
n = 21 (9.25%)
Threonine (Thr, T)
n = 19 (8.37%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 11 (4.85%)
Leucine (Leu, L)
n = 34 (14.98%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 16 (7.05%)
Proline (Pro, P)
n = 13 (5.73%)
Phenylalanine (Phe, F)
n = 6 (2.64%)
Tyrosine (Tyr, Y)
n = 11 (4.85%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 10 (4.41%)
Glutamic acid (Glu, E)
n = 15 (6.61%)
Asparagine (Asn, N)
n = 5 (2.2%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 7 (3.08%)
Lysine (Lys, K)
n = 6 (2.64%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 9 14 3 3 15 3 9 5 1 5 2 3 1 3 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 2 1 4 0 1 2 4 1 1 5 6 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 11 1 2 5 9 0 0 5 4 7 2 1 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 13 2 3 7 6 0 0 1 5 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 56 70 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
26 55 61 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 63 108 42
COX3 (size: 781 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.72%)
Alanine (Ala, A)
n = 15 (5.79%)
Serine (Ser, S)
n = 18 (6.95%)
Threonine (Thr, T)
n = 22 (8.49%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.18%)
Leucine (Leu, L)
n = 32 (12.36%)
Isoleucine (Ile, I)
n = 15 (5.79%)
Methionine (Met, M)
n = 10 (3.86%)
Proline (Pro, P)
n = 13 (5.02%)
Phenylalanine (Phe, F)
n = 24 (9.27%)
Tyrosine (Tyr, Y)
n = 11 (4.25%)
Tryptophan (Trp, W)
n = 12 (4.63%)
Aspartic acid (Asp, D)
n = 3 (1.16%)
Glutamic acid (Glu, E)
n = 8 (3.09%)
Asparagine (Asn, N)
n = 9 (3.47%)
Glutamine (Gln, Q)
n = 7 (2.7%)
Histidine (His, H)
n = 16 (6.18%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.93%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 5 8 2 8 13 2 6 7 0 4 4 5 3 10 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 2 4 6 5 0 2 8 8 2 3 5 5 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 8 1 7 2 5 0 1 3 4 7 1 1 2 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 0 1 2 2 0 0 2 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 66 62 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 64 56 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 95 94 59
CYTB (size: 1140 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.33%)
Alanine (Ala, A)
n = 27 (7.12%)
Serine (Ser, S)
n = 23 (6.07%)
Threonine (Thr, T)
n = 24 (6.33%)
Cysteine (Cys, C)
n = 4 (1.06%)
Valine (Val, V)
n = 16 (4.22%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 40 (10.55%)
Methionine (Met, M)
n = 21 (5.54%)
Proline (Pro, P)
n = 22 (5.8%)
Phenylalanine (Phe, F)
n = 24 (6.33%)
Tyrosine (Tyr, Y)
n = 16 (4.22%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 6 (1.58%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
20 20 20 3 17 31 3 3 5 1 4 3 9 0 7 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 4 4 7 16 0 0 6 15 3 1 6 15 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 16 1 3 4 11 1 1 3 4 12 1 0 7 11 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 1 1 9 7 2 0 0 8 0 1 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 102 117 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 92 77 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 132 173 61
ND1 (size: 957 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 12 (3.77%)
Alanine (Ala, A)
n = 29 (9.12%)
Serine (Ser, S)
n = 23 (7.23%)
Threonine (Thr, T)
n = 20 (6.29%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 13 (4.09%)
Leucine (Leu, L)
n = 55 (17.3%)
Isoleucine (Ile, I)
n = 32 (10.06%)
Methionine (Met, M)
n = 18 (5.66%)
Proline (Pro, P)
n = 22 (6.92%)
Phenylalanine (Phe, F)
n = 21 (6.6%)
Tyrosine (Tyr, Y)
n = 12 (3.77%)
Tryptophan (Trp, W)
n = 9 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.94%)
Glutamic acid (Glu, E)
n = 11 (3.46%)
Asparagine (Asn, N)
n = 12 (3.77%)
Glutamine (Gln, Q)
n = 7 (2.2%)
Histidine (His, H)
n = 3 (0.94%)
Lysine (Lys, K)
n = 7 (2.2%)
Arginine (Arg, R)
n = 8 (2.52%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 17 16 0 9 40 4 2 7 0 1 3 9 0 7 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 4 9 16 0 0 3 9 0 6 6 9 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 12 1 2 4 12 1 0 4 6 6 0 0 4 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 10 1 0 3 7 0 1 1 5 1 0 0 1 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 93 93 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 90 56 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 94 164 50
ND2 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 19 (5.49%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 55 (15.9%)
Isoleucine (Ile, I)
n = 33 (9.54%)
Methionine (Met, M)
n = 44 (12.72%)
Proline (Pro, P)
n = 18 (5.2%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 16 40 0 15 29 1 10 8 1 2 5 4 2 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 2 10 7 0 2 4 6 2 4 3 11 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 0 6 8 13 1 1 0 4 5 0 0 2 15 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 1 0 12 1 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 80 145 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 102 59 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 103 175 57
ND3 (size: 1042 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.05%)
Alanine (Ala, A)
n = 19 (5.49%)
Serine (Ser, S)
n = 29 (8.38%)
Threonine (Thr, T)
n = 37 (10.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 13 (3.76%)
Leucine (Leu, L)
n = 55 (15.9%)
Isoleucine (Ile, I)
n = 33 (9.54%)
Methionine (Met, M)
n = 44 (12.72%)
Proline (Pro, P)
n = 18 (5.2%)
Phenylalanine (Phe, F)
n = 13 (3.76%)
Tyrosine (Tyr, Y)
n = 9 (2.6%)
Tryptophan (Trp, W)
n = 10 (2.89%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 17 (4.91%)
Glutamine (Gln, Q)
n = 9 (2.6%)
Histidine (His, H)
n = 5 (1.45%)
Lysine (Lys, K)
n = 13 (3.76%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 16 40 0 15 29 1 10 8 1 2 5 4 2 4 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 0 2 10 7 0 2 4 6 2 4 3 11 0 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 17 0 6 8 13 1 1 0 4 5 0 0 2 15 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 0 1 0 12 1 0 0 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
52 80 145 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 102 59 158
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 103 175 57
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.93%)
Alanine (Ala, A)
n = 27 (5.9%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 35 (7.64%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 17 (3.71%)
Leucine (Leu, L)
n = 92 (20.09%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 38 (8.3%)
Proline (Pro, P)
n = 22 (4.8%)
Phenylalanine (Phe, F)
n = 21 (4.59%)
Tyrosine (Tyr, Y)
n = 15 (3.28%)
Tryptophan (Trp, W)
n = 13 (2.84%)
Aspartic acid (Asp, D)
n = 3 (0.66%)
Glutamic acid (Glu, E)
n = 9 (1.97%)
Asparagine (Asn, N)
n = 24 (5.24%)
Glutamine (Gln, Q)
n = 11 (2.4%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 11 (2.4%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 22 33 11 12 46 7 14 10 1 1 5 11 0 11 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 3 0 3 12 11 1 2 6 8 2 3 10 9 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 18 0 7 13 9 0 2 8 6 9 0 2 7 17 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 6 3 1 2 10 1 0 2 8 0 0 0 0 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 130 158 97
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 113 84 208
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
22 144 206 87
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 7 (7.14%)
Serine (Ser, S)
n = 10 (10.2%)
Threonine (Thr, T)
n = 5 (5.1%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 8 (8.16%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 13 (13.27%)
Proline (Pro, P)
n = 1 (1.02%)
Phenylalanine (Phe, F)
n = 4 (4.08%)
Tyrosine (Tyr, Y)
n = 4 (4.08%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 2 (2.04%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 1 (1.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 12 2 3 12 2 2 2 0 1 1 6 0 3 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 1 2 0 5 0 0 1 2 1 1 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 1 1 1 6 2 0 0 1 2 2 0 1 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 0 0 1 0 0 0 0 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 25 28 24
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
9 22 17 51
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
6 26 48 19
ND5 (size: 1821 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (4.62%)
Alanine (Ala, A)
n = 38 (6.27%)
Serine (Ser, S)
n = 49 (8.09%)
Threonine (Thr, T)
n = 57 (9.41%)
Cysteine (Cys, C)
n = 5 (0.83%)
Valine (Val, V)
n = 16 (2.64%)
Leucine (Leu, L)
n = 85 (14.03%)
Isoleucine (Ile, I)
n = 60 (9.9%)
Methionine (Met, M)
n = 48 (7.92%)
Proline (Pro, P)
n = 27 (4.46%)
Phenylalanine (Phe, F)
n = 47 (7.76%)
Tyrosine (Tyr, Y)
n = 16 (2.64%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 11 (1.82%)
Glutamic acid (Glu, E)
n = 11 (1.82%)
Asparagine (Asn, N)
n = 34 (5.61%)
Glutamine (Gln, Q)
n = 19 (3.14%)
Histidine (His, H)
n = 13 (2.15%)
Lysine (Lys, K)
n = 22 (3.63%)
Arginine (Arg, R)
n = 8 (1.32%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
21 39 44 12 13 48 0 12 15 4 2 7 7 0 21 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 4 4 17 16 1 2 11 15 0 3 14 9 1 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 29 2 6 16 13 0 2 12 2 14 4 0 8 26 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 9 2 7 4 21 1 2 3 3 0 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
104 140 235 128
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
67 157 127 256
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 236 250 102
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (14.86%)
Alanine (Ala, A)
n = 5 (2.86%)
Serine (Ser, S)
n = 12 (6.86%)
Threonine (Thr, T)
n = 9 (5.14%)
Cysteine (Cys, C)
n = 1 (0.57%)
Valine (Val, V)
n = 22 (12.57%)
Leucine (Leu, L)
n = 16 (9.14%)
Isoleucine (Ile, I)
n = 18 (10.29%)
Methionine (Met, M)
n = 11 (6.29%)
Proline (Pro, P)
n = 3 (1.71%)
Phenylalanine (Phe, F)
n = 15 (8.57%)
Tyrosine (Tyr, Y)
n = 10 (5.71%)
Tryptophan (Trp, W)
n = 4 (2.29%)
Aspartic acid (Asp, D)
n = 4 (2.29%)
Glutamic acid (Glu, E)
n = 9 (5.14%)
Asparagine (Asn, N)
n = 4 (2.29%)
Glutamine (Gln, Q)
n = 1 (0.57%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 4 (2.29%)
Arginine (Arg, R)
n = 1 (0.57%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 0 6 0 0 1 1 8 0 1 8 0 7 7 15 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 0 4 0 1 0 12 1 5 8 3 0 0 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 4 0 6 0 1 1 4 0 8 2 3 6 4 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 9 4 0 1 3 1 0 0 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
66 7 50 53
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 25 33 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
44 3 36 93
Total protein-coding genes (size: 11401 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 215 (5.66%)
Alanine (Ala, A)
n = 242 (6.37%)
Serine (Ser, S)
n = 282 (7.42%)
Threonine (Thr, T)
n = 310 (8.16%)
Cysteine (Cys, C)
n = 23 (0.61%)
Valine (Val, V)
n = 181 (4.77%)
Leucine (Leu, L)
n = 592 (15.59%)
Isoleucine (Ile, I)
n = 333 (8.77%)
Methionine (Met, M)
n = 275 (7.24%)
Proline (Pro, P)
n = 193 (5.08%)
Phenylalanine (Phe, F)
n = 241 (6.35%)
Tyrosine (Tyr, Y)
n = 130 (3.42%)
Tryptophan (Trp, W)
n = 104 (2.74%)
Aspartic acid (Asp, D)
n = 65 (1.71%)
Glutamic acid (Glu, E)
n = 97 (2.55%)
Asparagine (Asn, N)
n = 165 (4.34%)
Glutamine (Gln, Q)
n = 89 (2.34%)
Histidine (His, H)
n = 94 (2.47%)
Lysine (Lys, K)
n = 96 (2.53%)
Arginine (Arg, R)
n = 63 (1.66%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
176 157 244 52 100 298 30 95 79 10 32 48 86 15 108 133
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
31 10 13 39 94 105 4 29 55 104 27 42 61 86 4 62
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
77 163 8 51 67 100 6 15 43 52 78 12 17 50 115 26
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
68 77 20 26 39 88 8 5 13 44 1 1 0 8 0 92
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
800 919 1238 842
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
464 969 744 1622
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
193 1161 1670 775

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.