Viewing data for Carpodacus erythrinus


Scientific name Carpodacus erythrinus
Common name Common rosefinch
Maximum lifespan 9.00 years (Carpodacus erythrinus@AnAge)

Total mtDNA (size: 16820 bases) GC AT G C A T
Base content (bases) 7737 9082 5268 2469 4006 5076
Base content per 1 kb (bases) 460 540 313 147 238 302
Base content (%) 46.0% 54.0%
Total protein-coding genes (size: 11378 bases) GC AT G C A T
Base content (bases) 5361 6016 3857 1504 2689 3327
Base content per 1 kb (bases) 471 529 339 132 236 292
Base content (%) 47.1% 52.9%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1542 bases) GC AT G C A T
Base content (bases) 651 891 380 271 388 503
Base content per 1 kb (bases) 422 578 246 176 252 326
Base content (%) 42.2% 57.8%
Total rRNA-coding genes (size: 2571 bases) GC AT G C A T
Base content (bases) 1161 1410 636 525 556 854
Base content per 1 kb (bases) 452 548 247 204 216 332
Base content (%) 45.2% 54.8%
12S rRNA gene (size: 973 bases) GC AT G C A T
Base content (bases) 466 507 259 207 206 301
Base content per 1 kb (bases) 479 521 266 213 212 309
Base content (%) 47.9% 52.1%
16S rRNA gene (size: 1598 bases) GC AT G C A T
Base content (bases) 695 903 377 318 350 553
Base content per 1 kb (bases) 435 565 236 199 219 346
Base content (%) 43.5% 56.5%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 332 352 252 80 156 196
Base content per 1 kb (bases) 485 515 368 117 228 287
Base content (%) 48.5% 51.5%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 77 91 65 12 44 47
Base content per 1 kb (bases) 458 542 387 71 262 280
Base content (%) 45.8% 54.2%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 739 812 470 269 388 424
Base content per 1 kb (bases) 476 524 303 173 250 273
Base content (%) 47.6% 52.4%
COX2 (size: 684 bases) GC AT G C A T
Base content (bases) 321 363 215 106 156 207
Base content per 1 kb (bases) 469 531 314 155 228 303
Base content (%) 46.9% 53.1%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 391 393 268 123 183 210
Base content per 1 kb (bases) 499 501 342 157 233 268
Base content (%) 49.9% 50.1%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 546 597 390 156 282 315
Base content per 1 kb (bases) 478 522 341 136 247 276
Base content (%) 47.8% 52.2%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 453 525 309 144 264 261
Base content per 1 kb (bases) 463 537 316 147 270 267
Base content (%) 46.3% 53.7%
ND2 (size: 1040 bases) GC AT G C A T
Base content (bases) 461 579 352 109 258 321
Base content per 1 kb (bases) 443 557 338 105 248 309
Base content (%) 44.3% 55.7%
ND3 (size: 351 bases) GC AT G C A T
Base content (bases) 157 194 113 44 94 100
Base content per 1 kb (bases) 447 553 322 125 268 285
Base content (%) 44.7% 55.3%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 648 730 491 157 314 416
Base content per 1 kb (bases) 470 530 356 114 228 302
Base content (%) 47.0% 53.0%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 136 161 101 35 79 82
Base content per 1 kb (bases) 458 542 340 118 266 276
Base content (%) 45.8% 54.2%
ND5 (size: 1818 bases) GC AT G C A T
Base content (bases) 846 972 626 220 414 558
Base content per 1 kb (bases) 465 535 344 121 228 307
Base content (%) 46.5% 53.5%
ND6 (size: 519 bases) GC AT G C A T
Base content (bases) 259 259 208 51 61 198
Base content per 1 kb (bases) 499 499 401 98 118 382
Base content (%) 49.9% 49.9%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (3.08%)
Alanine (Ala, A)
n = 18 (7.93%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 22 (9.69%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 9 (3.96%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 18 (7.93%)
Methionine (Met, M)
n = 8 (3.52%)
Proline (Pro, P)
n = 15 (6.61%)
Phenylalanine (Phe, F)
n = 11 (4.85%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 3 (1.32%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 8 (3.52%)
Glutamine (Gln, Q)
n = 8 (3.52%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 16 7 3 14 30 9 5 8 0 1 3 4 1 0 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 13 4 1 1 3 2 1 2 5 8 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 9 3 2 3 5 1 0 5 0 3 0 0 0 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 3 3 1 0 2 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
41 87 65 35
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 66 34 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 99 97 14
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFFIMLISWFTLSLIIQPKLLSFVSMNPPSSKPPIAPSTTPWTWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.64%)
Serine (Ser, S)
n = 7 (12.73%)
Threonine (Thr, T)
n = 5 (9.09%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 5 (9.09%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 11 (20.0%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 2 (3.64%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 2 (3.64%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 3 1 2 3 1 0 0 2 0 0 0 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 1 0 0 0 0 0 0 1 5 5 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 0 0 1 1 3 0 0 2 0 0 0 0 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 19 19 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 23 7 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 23 21 10
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 45 (8.72%)
Serine (Ser, S)
n = 28 (5.43%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 41 (7.95%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 22 (4.26%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 43 (8.33%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 9 (1.74%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 27 18 7 12 31 9 4 9 0 6 14 14 7 8 35
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 1 6 22 14 3 6 9 27 5 5 9 15 1 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 19 0 6 5 12 1 0 4 4 13 1 0 1 14 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 10 0 5 10 9 0 1 2 4 1 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
158 125 128 106
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
78 138 94 207
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 207 202 75
COX2 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 15 (6.61%)
Serine (Ser, S)
n = 23 (10.13%)
Threonine (Thr, T)
n = 16 (7.05%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 18 (7.93%)
Leucine (Leu, L)
n = 30 (13.22%)
Isoleucine (Ile, I)
n = 13 (5.73%)
Methionine (Met, M)
n = 12 (5.29%)
Proline (Pro, P)
n = 12 (5.29%)
Phenylalanine (Phe, F)
n = 9 (3.96%)
Tyrosine (Tyr, Y)
n = 7 (3.08%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 12 (5.29%)
Glutamic acid (Glu, E)
n = 12 (5.29%)
Asparagine (Asn, N)
n = 6 (2.64%)
Glutamine (Gln, Q)
n = 6 (2.64%)
Histidine (His, H)
n = 9 (3.96%)
Lysine (Lys, K)
n = 5 (2.2%)
Arginine (Arg, R)
n = 6 (2.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 8 7 7 5 13 3 2 5 1 2 6 8 2 0 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 3 3 7 5 0 1 2 4 1 2 2 8 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 8 0 2 10 5 0 0 6 2 5 0 0 2 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 1 1 11 5 0 0 2 4 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
65 61 58 44
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 60 58 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
13 94 91 30
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 20 (7.69%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 15 (5.77%)
Leucine (Leu, L)
n = 33 (12.69%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 7 (2.69%)
Proline (Pro, P)
n = 13 (5.0%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 13 6 0 10 18 2 3 8 0 2 5 6 2 2 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 1 2 16 6 0 0 8 12 0 2 5 5 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 8 1 5 4 5 0 0 4 4 7 0 0 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 7 1 0 4 4 0 2 1 2 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 72 54 64
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 71 54 93
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 125 102 25
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (6.32%)
Alanine (Ala, A)
n = 28 (7.37%)
Serine (Ser, S)
n = 21 (5.53%)
Threonine (Thr, T)
n = 27 (7.11%)
Cysteine (Cys, C)
n = 4 (1.05%)
Valine (Val, V)
n = 24 (6.32%)
Leucine (Leu, L)
n = 63 (16.58%)
Isoleucine (Ile, I)
n = 33 (8.68%)
Methionine (Met, M)
n = 7 (1.84%)
Proline (Pro, P)
n = 24 (6.32%)
Phenylalanine (Phe, F)
n = 28 (7.37%)
Tyrosine (Tyr, Y)
n = 12 (3.16%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 9 (2.37%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 20 (5.26%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 12 (3.16%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 24 4 10 13 32 5 3 8 0 4 11 9 0 2 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 4 5 15 6 2 3 9 9 3 3 8 13 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 14 0 3 7 8 2 0 1 1 11 0 0 3 17 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 6 1 0 9 10 0 2 2 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
92 112 98 79
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
48 99 79 155
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 179 138 48
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 30 (9.23%)
Serine (Ser, S)
n = 27 (8.31%)
Threonine (Thr, T)
n = 19 (5.85%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 16 (4.92%)
Leucine (Leu, L)
n = 66 (20.31%)
Isoleucine (Ile, I)
n = 23 (7.08%)
Methionine (Met, M)
n = 11 (3.38%)
Proline (Pro, P)
n = 25 (7.69%)
Phenylalanine (Phe, F)
n = 17 (5.23%)
Tyrosine (Tyr, Y)
n = 16 (4.92%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 13 (4.0%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 14 4 11 10 29 8 7 5 1 1 4 8 3 5 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 2 2 13 14 1 1 5 5 3 6 8 11 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 8 0 6 10 4 1 0 6 8 8 3 1 3 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 9 2 1 3 7 0 2 1 5 0 1 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 99 80 72
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 95 59 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
30 115 122 59
ND2 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.06%)
Alanine (Ala, A)
n = 27 (7.83%)
Serine (Ser, S)
n = 29 (8.41%)
Threonine (Thr, T)
n = 43 (12.46%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.19%)
Leucine (Leu, L)
n = 71 (20.58%)
Isoleucine (Ile, I)
n = 27 (7.83%)
Methionine (Met, M)
n = 18 (5.22%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 17 17 11 19 26 4 10 6 4 1 6 4 0 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 3 11 12 1 2 4 7 1 3 8 10 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 14 1 1 13 9 2 0 4 1 6 1 1 4 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 1 0 12 2 0 1 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 104 118 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 116 58 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 132 144 52
ND3 (size: 1040 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.06%)
Alanine (Ala, A)
n = 27 (7.83%)
Serine (Ser, S)
n = 29 (8.41%)
Threonine (Thr, T)
n = 43 (12.46%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 11 (3.19%)
Leucine (Leu, L)
n = 71 (20.58%)
Isoleucine (Ile, I)
n = 27 (7.83%)
Methionine (Met, M)
n = 18 (5.22%)
Proline (Pro, P)
n = 21 (6.09%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 10 (2.9%)
Histidine (His, H)
n = 9 (2.61%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 17 17 11 19 26 4 10 6 4 1 6 4 0 4 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 3 11 12 1 2 4 7 1 3 8 10 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
19 14 1 1 13 9 2 0 4 1 6 1 1 4 8 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 5 0 1 0 12 2 0 1 3 0 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
58 104 118 66
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 116 58 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 132 144 52
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (4.15%)
Alanine (Ala, A)
n = 42 (9.17%)
Serine (Ser, S)
n = 37 (8.08%)
Threonine (Thr, T)
n = 38 (8.3%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 96 (20.96%)
Isoleucine (Ile, I)
n = 44 (9.61%)
Methionine (Met, M)
n = 25 (5.46%)
Proline (Pro, P)
n = 27 (5.9%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 16 (3.49%)
Glutamine (Gln, Q)
n = 15 (3.28%)
Histidine (His, H)
n = 14 (3.06%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 34 19 8 27 50 5 6 13 2 3 3 4 0 1 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 3 7 22 12 1 0 11 6 2 1 12 14 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 16 2 6 8 14 0 2 7 0 13 1 0 0 16 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 9 1 0 2 10 0 0 1 10 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 157 142 77
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
54 135 80 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 199 194 46
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 4 (4.08%)
Alanine (Ala, A)
n = 9 (9.18%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 7 (7.14%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 19 (19.39%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 7 (7.14%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 5 (5.1%)
Tyrosine (Tyr, Y)
n = 3 (3.06%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 4 5 1 2 12 1 3 3 0 0 0 2 0 1 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 2 6 1 0 1 3 0 0 2 0 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
4 2 0 4 2 4 0 0 4 1 2 0 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 0 0 1 0 0 0 0 2 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
18 30 25 26
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 29 18 38
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 42 39 15
ND5 (size: 1818 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.45%)
Alanine (Ala, A)
n = 54 (8.93%)
Serine (Ser, S)
n = 51 (8.43%)
Threonine (Thr, T)
n = 64 (10.58%)
Cysteine (Cys, C)
n = 6 (0.99%)
Valine (Val, V)
n = 19 (3.14%)
Leucine (Leu, L)
n = 101 (16.69%)
Isoleucine (Ile, I)
n = 54 (8.93%)
Methionine (Met, M)
n = 27 (4.46%)
Proline (Pro, P)
n = 29 (4.79%)
Phenylalanine (Phe, F)
n = 37 (6.12%)
Tyrosine (Tyr, Y)
n = 13 (2.15%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 8 (1.32%)
Glutamic acid (Glu, E)
n = 12 (1.98%)
Asparagine (Asn, N)
n = 28 (4.63%)
Glutamine (Gln, Q)
n = 16 (2.64%)
Histidine (His, H)
n = 12 (1.98%)
Lysine (Lys, K)
n = 20 (3.31%)
Arginine (Arg, R)
n = 9 (1.49%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 39 23 6 25 56 9 5 15 1 3 6 10 0 6 31
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 6 3 35 15 1 1 11 20 1 9 9 11 0 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
31 24 1 2 21 15 1 2 10 1 12 0 0 3 25 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 11 1 1 7 18 2 1 1 7 0 1 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
126 162 206 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 186 109 238
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 278 243 64
ND6 (size: 519 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 30 (17.44%)
Alanine (Ala, A)
n = 12 (6.98%)
Serine (Ser, S)
n = 15 (8.72%)
Threonine (Thr, T)
n = 2 (1.16%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 35 (20.35%)
Leucine (Leu, L)
n = 33 (19.19%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 5 (2.91%)
Proline (Pro, P)
n = 4 (2.33%)
Phenylalanine (Phe, F)
n = 7 (4.07%)
Tyrosine (Tyr, Y)
n = 6 (3.49%)
Tryptophan (Trp, W)
n = 4 (2.33%)
Aspartic acid (Asp, D)
n = 2 (1.16%)
Glutamic acid (Glu, E)
n = 6 (3.49%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 4 (2.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 1 3 0 2 5 8 0 0 16 1 3 15 6 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 2 0 4 0 5 3 7 0 5 18 2 0 0 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 1 5 1 1 4 4 0 6 0 2 15 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 5 2 0 0 0 0 0 0 4 0 0 0 1 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
85 18 15 54
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 29 17 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
79 4 28 61
Total protein-coding genes (size: 11395 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 225 (5.93%)
Alanine (Ala, A)
n = 313 (8.25%)
Serine (Ser, S)
n = 294 (7.74%)
Threonine (Thr, T)
n = 311 (8.19%)
Cysteine (Cys, C)
n = 27 (0.71%)
Valine (Val, V)
n = 202 (5.32%)
Leucine (Leu, L)
n = 670 (17.65%)
Isoleucine (Ile, I)
n = 287 (7.56%)
Methionine (Met, M)
n = 156 (4.11%)
Proline (Pro, P)
n = 221 (5.82%)
Phenylalanine (Phe, F)
n = 221 (5.82%)
Tyrosine (Tyr, Y)
n = 110 (2.9%)
Tryptophan (Trp, W)
n = 106 (2.79%)
Aspartic acid (Asp, D)
n = 64 (1.69%)
Glutamic acid (Glu, E)
n = 94 (2.48%)
Asparagine (Asn, N)
n = 131 (3.45%)
Glutamine (Gln, Q)
n = 94 (2.48%)
Histidine (His, H)
n = 101 (2.66%)
Lysine (Lys, K)
n = 86 (2.27%)
Arginine (Arg, R)
n = 73 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
83 204 115 70 146 318 62 56 85 9 39 59 74 30 39 182
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
41 4 23 39 166 95 13 23 67 99 36 39 73 104 5 47
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
130 125 9 44 88 87 13 8 54 28 82 8 18 19 112 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
90 82 12 12 52 81 5 8 13 46 6 2 1 6 1 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
898 1085 1036 777
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
496 1077 687 1536
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
269 1541 1473 513

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.