Viewing data for Acipenser transmontanus


Scientific name Acipenser transmontanus
Common name White sturgeon
Maximum lifespan 104.00 years (Acipenser transmontanus@AnAge)

Total mtDNA (size: 16692 bases) GC AT G C A T
Base content (bases) 7651 9041 4912 2739 4010 5031
Base content per 1 kb (bases) 458 542 294 164 240 301
Base content (%) 45.8% 54.2%
Total protein-coding genes (size: 11412 bases) GC AT G C A T
Base content (bases) 5331 6081 3615 1716 2790 3291
Base content per 1 kb (bases) 467 533 317 150 244 288
Base content (%) 46.7% 53.3%
D-loop (size: 979 bases) GC AT G C A T
Base content (bases) 359 620 210 149 302 318
Base content per 1 kb (bases) 367 633 215 152 308 325
Base content (%) 36.7% 63.3%
Total tRNA-coding genes (size: 1548 bases) GC AT G C A T
Base content (bases) 682 866 375 307 388 478
Base content per 1 kb (bases) 441 559 242 198 251 309
Base content (%) 44.1% 55.9%
Total rRNA-coding genes (size: 2662 bases) GC AT G C A T
Base content (bases) 1228 1434 684 544 514 920
Base content per 1 kb (bases) 461 539 257 204 193 346
Base content (%) 46.1% 53.9%
12S rRNA gene (size: 961 bases) GC AT G C A T
Base content (bases) 474 487 267 207 180 307
Base content per 1 kb (bases) 493 507 278 215 187 319
Base content (%) 49.3% 50.7%
16S rRNA gene (size: 1701 bases) GC AT G C A T
Base content (bases) 754 947 417 337 334 613
Base content per 1 kb (bases) 443 557 245 198 196 360
Base content (%) 44.3% 55.7%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 329 354 235 94 174 180
Base content per 1 kb (bases) 482 518 344 138 255 264
Base content (%) 48.2% 51.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 70 98 50 20 43 55
Base content per 1 kb (bases) 417 583 298 119 256 327
Base content (%) 41.7% 58.3%
COX1 (size: 1554 bases) GC AT G C A T
Base content (bases) 749 805 450 299 418 387
Base content per 1 kb (bases) 482 518 290 192 269 249
Base content (%) 48.2% 51.8%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 304 387 189 115 172 215
Base content per 1 kb (bases) 440 560 274 166 249 311
Base content (%) 44.0% 56.0%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 375 410 243 132 197 213
Base content per 1 kb (bases) 478 522 310 168 251 271
Base content (%) 47.8% 52.2%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 530 611 363 167 297 314
Base content per 1 kb (bases) 465 535 318 146 260 275
Base content (%) 46.5% 53.5%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 456 519 312 144 250 269
Base content per 1 kb (bases) 468 532 320 148 256 276
Base content (%) 46.8% 53.2%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 483 562 349 134 230 332
Base content per 1 kb (bases) 462 538 334 128 220 318
Base content (%) 46.2% 53.8%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 166 183 107 59 99 84
Base content per 1 kb (bases) 476 524 307 169 284 241
Base content (%) 47.6% 52.4%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 645 736 435 210 338 398
Base content per 1 kb (bases) 467 533 315 152 245 288
Base content (%) 46.7% 53.3%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 147 150 105 42 76 74
Base content per 1 kb (bases) 495 505 354 141 256 249
Base content (%) 49.5% 50.5%
ND5 (size: 1842 bases) GC AT G C A T
Base content (bases) 834 1008 596 238 443 565
Base content per 1 kb (bases) 453 547 324 129 240 307
Base content (%) 45.3% 54.7%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 249 273 185 64 59 214
Base content per 1 kb (bases) 477 523 354 123 113 410
Base content (%) 47.7% 52.3%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 18 (7.96%)
Serine (Ser, S)
n = 7 (3.1%)
Threonine (Thr, T)
n = 21 (9.29%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 14 (6.19%)
Leucine (Leu, L)
n = 56 (24.78%)
Isoleucine (Ile, I)
n = 20 (8.85%)
Methionine (Met, M)
n = 10 (4.42%)
Proline (Pro, P)
n = 17 (7.52%)
Phenylalanine (Phe, F)
n = 10 (4.42%)
Tyrosine (Tyr, Y)
n = 3 (1.33%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 10 (4.42%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 4 (1.77%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 10 7 7 15 17 10 7 9 0 3 3 7 1 6 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 8 7 0 1 6 4 0 1 11 3 2 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 7 1 0 1 1 0 0 5 0 3 2 0 0 10 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 4 0 0 1 1 0 0 3 3 0 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 85 67 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 58 32 110
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 92 80 36
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPSPWFMILIFSWLIFLIILPPKVLGHTFTNEPTHKNAEKIKPEPWTWPWS*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 1 (1.82%)
Serine (Ser, S)
n = 3 (5.45%)
Threonine (Thr, T)
n = 4 (7.27%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 1 (1.82%)
Leucine (Leu, L)
n = 6 (10.91%)
Isoleucine (Ile, I)
n = 6 (10.91%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 9 (16.36%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 3 (5.45%)
Glutamine (Gln, Q)
n = 1 (1.82%)
Histidine (His, H)
n = 2 (3.64%)
Lysine (Lys, K)
n = 4 (7.27%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 0 1 1 0 2 2 1 1 0 0 0 0 1 1 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 1 0 0 2 4 2 1 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 0 1 0 1 1 0 0 1 0 0 0 0 1 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 3 0 0 0 3 1 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 17 20 13
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
7 16 14 19
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
7 17 21 11
COX1 (size: 1554 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.09%)
Alanine (Ala, A)
n = 48 (9.28%)
Serine (Ser, S)
n = 29 (5.61%)
Threonine (Thr, T)
n = 36 (6.96%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 44 (8.51%)
Leucine (Leu, L)
n = 62 (11.99%)
Isoleucine (Ile, I)
n = 37 (7.16%)
Methionine (Met, M)
n = 25 (4.84%)
Proline (Pro, P)
n = 28 (5.42%)
Phenylalanine (Phe, F)
n = 41 (7.93%)
Tyrosine (Tyr, Y)
n = 19 (3.68%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.9%)
Glutamic acid (Glu, E)
n = 10 (1.93%)
Asparagine (Asn, N)
n = 15 (2.9%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 8 (1.55%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 18 15 8 8 23 10 11 5 3 5 11 18 10 17 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 0 1 7 28 10 3 5 19 17 6 4 12 11 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
15 17 2 4 10 9 2 0 4 7 12 3 2 4 11 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 3 3 12 7 1 2 2 2 2 0 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
164 112 125 117
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 137 95 209
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
58 201 167 92
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 15 (6.55%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 11 (4.8%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 20 (8.73%)
Leucine (Leu, L)
n = 28 (12.23%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 8 (3.49%)
Tyrosine (Tyr, Y)
n = 10 (4.37%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 12 (5.24%)
Glutamic acid (Glu, E)
n = 16 (6.99%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 5 7 4 5 14 2 3 8 0 3 4 10 3 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 0 2 2 6 5 2 0 3 5 1 1 6 7 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 6 2 3 6 5 0 1 2 5 5 1 0 2 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 14 2 2 10 4 0 0 1 5 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
72 63 53 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 54 65 86
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 72 97 43
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (7.69%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 12 (4.62%)
Threonine (Thr, T)
n = 24 (9.23%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 17 (6.54%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 15 (5.77%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 23 (8.85%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 10 (3.85%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 9 (3.46%)
Histidine (His, H)
n = 15 (5.77%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 6 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 8 5 6 6 11 4 4 9 0 2 8 6 1 11 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 2 2 9 11 1 0 8 9 3 1 5 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 10 1 3 3 3 0 0 3 3 9 0 0 1 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 10 0 1 4 2 0 0 2 4 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 69 55 62
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 68 55 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 106 102 39
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (7.39%)
Alanine (Ala, A)
n = 28 (7.39%)
Serine (Ser, S)
n = 22 (5.8%)
Threonine (Thr, T)
n = 25 (6.6%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 24 (6.33%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 28 (7.39%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 31 (8.18%)
Tyrosine (Tyr, Y)
n = 13 (3.43%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 11 (2.9%)
Glutamic acid (Glu, E)
n = 4 (1.06%)
Asparagine (Asn, N)
n = 21 (5.54%)
Glutamine (Gln, Q)
n = 9 (2.37%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
9 19 8 8 19 19 5 6 9 0 1 7 11 5 12 19
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 3 3 17 7 1 3 10 14 1 0 10 10 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 15 0 5 8 8 0 0 1 4 9 1 2 5 16 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 4 0 2 9 9 0 0 0 8 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
95 101 95 89
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 95 79 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 167 140 54
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (5.56%)
Alanine (Ala, A)
n = 34 (10.49%)
Serine (Ser, S)
n = 19 (5.86%)
Threonine (Thr, T)
n = 19 (5.86%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 15 (4.63%)
Leucine (Leu, L)
n = 61 (18.83%)
Isoleucine (Ile, I)
n = 26 (8.02%)
Methionine (Met, M)
n = 14 (4.32%)
Proline (Pro, P)
n = 24 (7.41%)
Phenylalanine (Phe, F)
n = 17 (5.25%)
Tyrosine (Tyr, Y)
n = 14 (4.32%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 13 (4.01%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 20 12 3 15 29 4 8 5 1 2 3 7 3 8 9
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 0 4 16 13 1 3 9 4 2 4 8 11 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 7 0 4 7 5 1 1 1 6 8 0 2 4 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 6 5 0 4 5 2 1 0 7 0 0 0 0 1 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
82 94 81 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 94 61 133
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
25 124 127 49
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 36 (10.37%)
Serine (Ser, S)
n = 25 (7.2%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 28 (8.07%)
Methionine (Met, M)
n = 24 (6.92%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 18 18 7 13 26 9 6 11 3 1 3 3 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 3 20 12 1 1 8 5 2 0 12 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 22 0 2 7 9 0 4 3 3 6 3 1 3 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 1 0 1 9 1 0 0 4 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 96 130 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 120 58 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 133 144 43
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 36 (10.37%)
Serine (Ser, S)
n = 25 (7.2%)
Threonine (Thr, T)
n = 48 (13.83%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 8 (2.31%)
Leucine (Leu, L)
n = 62 (17.87%)
Isoleucine (Ile, I)
n = 28 (8.07%)
Methionine (Met, M)
n = 24 (6.92%)
Proline (Pro, P)
n = 18 (5.19%)
Phenylalanine (Phe, F)
n = 9 (2.59%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.73%)
Asparagine (Asn, N)
n = 13 (3.75%)
Glutamine (Gln, Q)
n = 14 (4.03%)
Histidine (His, H)
n = 5 (1.44%)
Lysine (Lys, K)
n = 10 (2.88%)
Arginine (Arg, R)
n = 4 (1.15%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 18 18 7 13 26 9 6 11 3 1 3 3 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 0 3 20 12 1 1 8 5 2 0 12 6 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
21 22 0 2 7 9 0 4 3 3 6 3 1 3 10 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 5 1 0 1 9 1 0 0 4 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 96 130 55
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 120 58 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 133 144 43
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (5.66%)
Alanine (Ala, A)
n = 41 (8.93%)
Serine (Ser, S)
n = 30 (6.54%)
Threonine (Thr, T)
n = 40 (8.71%)
Cysteine (Cys, C)
n = 6 (1.31%)
Valine (Val, V)
n = 17 (3.7%)
Leucine (Leu, L)
n = 86 (18.74%)
Isoleucine (Ile, I)
n = 42 (9.15%)
Methionine (Met, M)
n = 27 (5.88%)
Proline (Pro, P)
n = 27 (5.88%)
Phenylalanine (Phe, F)
n = 14 (3.05%)
Tyrosine (Tyr, Y)
n = 14 (3.05%)
Tryptophan (Trp, W)
n = 19 (4.14%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 13 (2.83%)
Asparagine (Asn, N)
n = 13 (2.83%)
Glutamine (Gln, Q)
n = 12 (2.61%)
Histidine (His, H)
n = 9 (1.96%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
19 23 17 12 16 35 12 10 10 2 4 4 8 1 4 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
10 3 3 3 21 16 1 3 8 10 5 6 9 10 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
22 13 2 0 13 10 0 0 7 4 10 2 1 2 11 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 2 0 3 9 1 0 2 9 0 0 0 0 0 17
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
100 134 139 87
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
69 131 74 186
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
41 170 185 64
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 11 (11.22%)
Serine (Ser, S)
n = 9 (9.18%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 2 (2.04%)
Leucine (Leu, L)
n = 24 (24.49%)
Isoleucine (Ile, I)
n = 1 (1.02%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 2 (2.04%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 3 (3.06%)
Histidine (His, H)
n = 5 (5.1%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 4 3 8 8 1 3 3 0 0 0 2 0 1 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 2 1 7 3 0 0 2 3 1 1 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 0 3 3 1 0 0 2 0 1 0 1 1 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
23 32 21 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
14 30 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 43 37 14
ND5 (size: 1842 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.06%)
Alanine (Ala, A)
n = 49 (7.99%)
Serine (Ser, S)
n = 45 (7.34%)
Threonine (Thr, T)
n = 65 (10.6%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 23 (3.75%)
Leucine (Leu, L)
n = 94 (15.33%)
Isoleucine (Ile, I)
n = 55 (8.97%)
Methionine (Met, M)
n = 27 (4.4%)
Proline (Pro, P)
n = 30 (4.89%)
Phenylalanine (Phe, F)
n = 41 (6.69%)
Tyrosine (Tyr, Y)
n = 11 (1.79%)
Tryptophan (Trp, W)
n = 14 (2.28%)
Aspartic acid (Asp, D)
n = 12 (1.96%)
Glutamic acid (Glu, E)
n = 11 (1.79%)
Asparagine (Asn, N)
n = 30 (4.89%)
Glutamine (Gln, Q)
n = 22 (3.59%)
Histidine (His, H)
n = 16 (2.61%)
Lysine (Lys, K)
n = 22 (3.59%)
Arginine (Arg, R)
n = 9 (1.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 29 22 8 26 44 6 10 19 3 2 8 10 3 17 24
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 5 1 33 14 1 2 11 11 7 1 13 13 3 10
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
28 25 2 4 15 12 0 3 11 2 9 2 0 4 26 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
12 10 1 4 8 19 3 0 2 5 2 0 0 1 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
126 161 213 114
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 175 125 240
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 260 227 89
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 24 (13.87%)
Alanine (Ala, A)
n = 16 (9.25%)
Serine (Ser, S)
n = 12 (6.94%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 29 (16.76%)
Leucine (Leu, L)
n = 32 (18.5%)
Isoleucine (Ile, I)
n = 4 (2.31%)
Methionine (Met, M)
n = 4 (2.31%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 11 (6.36%)
Tyrosine (Tyr, Y)
n = 9 (5.2%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 5 (2.89%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 1 (0.58%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
4 0 1 6 1 1 3 8 0 0 9 2 3 15 10 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 0 9 0 2 5 7 0 3 14 4 0 0 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 1 5 1 1 3 2 0 7 2 5 13 0 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 4 4 1 0 1 2 0 0 2 0 0 0 1 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 20 17 59
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
37 35 22 80
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
70 9 20 75
Total protein-coding genes (size: 11433 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 243 (6.38%)
Alanine (Ala, A)
n = 331 (8.69%)
Serine (Ser, S)
n = 237 (6.23%)
Threonine (Thr, T)
n = 315 (8.27%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 218 (5.73%)
Leucine (Leu, L)
n = 628 (16.5%)
Isoleucine (Ile, I)
n = 289 (7.59%)
Methionine (Met, M)
n = 174 (4.57%)
Proline (Pro, P)
n = 214 (5.62%)
Phenylalanine (Phe, F)
n = 222 (5.83%)
Tyrosine (Tyr, Y)
n = 117 (3.07%)
Tryptophan (Trp, W)
n = 120 (3.15%)
Aspartic acid (Asp, D)
n = 74 (1.94%)
Glutamic acid (Glu, E)
n = 101 (2.65%)
Asparagine (Asn, N)
n = 130 (3.41%)
Glutamine (Gln, Q)
n = 104 (2.73%)
Histidine (His, H)
n = 103 (2.71%)
Lysine (Lys, K)
n = 79 (2.08%)
Arginine (Arg, R)
n = 74 (1.94%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
135 154 119 78 135 238 72 83 90 14 33 55 85 45 97 125
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
55 9 20 38 169 108 16 25 87 87 44 26 95 81 12 35
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
140 128 12 34 79 66 6 11 41 42 75 20 22 27 103 17
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
86 83 18 17 57 69 10 5 14 49 6 0 0 4 2 100
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
967 1018 1039 784
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
518 1045 714 1531
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
354 1435 1390 629

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.