Viewing data for Aythya fuligula


Scientific name Aythya fuligula
Common name Tufted duck
Maximum lifespan 45.20 years (Aythya fuligula@AnAge)

Total mtDNA (size: 16616 bases) GC AT G C A T
Base content (bases) 8041 8575 5462 2579 3686 4889
Base content per 1 kb (bases) 484 516 329 155 222 294
Base content (%) 48.4% 51.6%
Total protein-coding genes (size: 11388 bases) GC AT G C A T
Base content (bases) 5638 5750 4015 1623 2528 3222
Base content per 1 kb (bases) 495 505 353 143 222 283
Base content (%) 49.5% 50.5%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1541 bases) GC AT G C A T
Base content (bases) 670 871 395 275 378 493
Base content per 1 kb (bases) 435 565 256 178 245 320
Base content (%) 43.5% 56.5%
Total rRNA-coding genes (size: 2587 bases) GC AT G C A T
Base content (bases) 1204 1383 690 514 507 876
Base content per 1 kb (bases) 465 535 267 199 196 339
Base content (%) 46.5% 53.5%
12S rRNA gene (size: 984 bases) GC AT G C A T
Base content (bases) 474 510 277 197 188 322
Base content per 1 kb (bases) 482 518 282 200 191 327
Base content (%) 48.2% 51.8%
16S rRNA gene (size: 1603 bases) GC AT G C A T
Base content (bases) 730 873 413 317 319 554
Base content per 1 kb (bases) 455 545 258 198 199 346
Base content (%) 45.5% 54.5%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 333 351 254 79 159 192
Base content per 1 kb (bases) 487 513 371 115 232 281
Base content (%) 48.7% 51.3%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 81 87 68 13 30 57
Base content per 1 kb (bases) 482 518 405 77 179 339
Base content (%) 48.2% 51.8%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 775 776 511 264 374 402
Base content per 1 kb (bases) 500 500 329 170 241 259
Base content (%) 50.0% 50.0%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 345 342 228 117 152 190
Base content per 1 kb (bases) 502 498 332 170 221 277
Base content (%) 50.2% 49.8%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 394 390 266 128 181 209
Base content per 1 kb (bases) 503 497 339 163 231 267
Base content (%) 50.3% 49.7%
CYTB (size: 1143 bases) GC AT G C A T
Base content (bases) 577 566 414 163 264 302
Base content per 1 kb (bases) 505 495 362 143 231 264
Base content (%) 50.5% 49.5%
ND1 (size: 978 bases) GC AT G C A T
Base content (bases) 492 486 339 153 238 248
Base content per 1 kb (bases) 503 497 347 156 243 254
Base content (%) 50.3% 49.7%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 505 534 379 126 225 309
Base content per 1 kb (bases) 486 514 365 121 217 297
Base content (%) 48.6% 51.4%
ND3 (size: 352 bases) GC AT G C A T
Base content (bases) 179 173 121 58 85 88
Base content per 1 kb (bases) 509 491 344 165 241 250
Base content (%) 50.9% 49.1%
ND4 (size: 1378 bases) GC AT G C A T
Base content (bases) 663 715 497 166 311 404
Base content per 1 kb (bases) 481 519 361 120 226 293
Base content (%) 48.1% 51.9%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 149 148 101 48 71 77
Base content per 1 kb (bases) 502 498 340 162 239 259
Base content (%) 50.2% 49.8%
ND5 (size: 1824 bases) GC AT G C A T
Base content (bases) 887 937 639 248 389 548
Base content per 1 kb (bases) 486 514 350 136 213 300
Base content (%) 48.6% 51.4%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 263 259 201 62 53 206
Base content per 1 kb (bases) 504 496 385 119 102 395
Base content (%) 50.4% 49.6%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 17 (7.49%)
Serine (Ser, S)
n = 16 (7.05%)
Threonine (Thr, T)
n = 20 (8.81%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 8 (3.52%)
Leucine (Leu, L)
n = 61 (26.87%)
Isoleucine (Ile, I)
n = 19 (8.37%)
Methionine (Met, M)
n = 10 (4.41%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 8 (3.52%)
Tyrosine (Tyr, Y)
n = 4 (1.76%)
Tryptophan (Trp, W)
n = 4 (1.76%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 10 (4.41%)
Glutamine (Gln, Q)
n = 7 (3.08%)
Histidine (His, H)
n = 4 (1.76%)
Lysine (Lys, K)
n = 4 (1.76%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 14 7 7 15 28 7 3 6 1 0 5 2 1 1 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 3 9 5 0 0 5 2 1 2 7 6 2 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 10 1 1 6 4 0 0 5 1 3 1 1 1 9 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 4 0 0 1 3 1 0 0 5 0 0 0 1 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
38 90 68 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 65 35 106
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
19 99 89 21
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFSIMIMTWLTLALLIQPKLLTFTTTNPPSSKPSLTTKPTPWAWPWT*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 3 (5.45%)
Serine (Ser, S)
n = 4 (7.27%)
Threonine (Thr, T)
n = 10 (18.18%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 8 (14.55%)
Isoleucine (Ile, I)
n = 3 (5.45%)
Methionine (Met, M)
n = 3 (5.45%)
Proline (Pro, P)
n = 10 (18.18%)
Phenylalanine (Phe, F)
n = 2 (3.64%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 2 (3.64%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 3 1 0 4 3 1 0 1 1 0 0 0 0 1 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 1 2 0 0 0 0 0 1 3 6 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 3 0 0 1 2 0 0 1 0 0 0 0 0 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 0 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
3 20 22 11
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 26 8 16
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 22 27 3
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 47 (9.11%)
Alanine (Ala, A)
n = 46 (8.91%)
Serine (Ser, S)
n = 27 (5.23%)
Threonine (Thr, T)
n = 39 (7.56%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 33 (6.4%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 44 (8.53%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 30 (5.81%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 17 (3.29%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 15 (2.91%)
Glutamic acid (Glu, E)
n = 10 (1.94%)
Asparagine (Asn, N)
n = 15 (2.91%)
Glutamine (Gln, Q)
n = 10 (1.94%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 33 21 3 18 27 8 7 6 4 6 11 12 4 9 33
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 1 6 31 9 0 5 16 19 7 7 11 10 2 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
23 14 1 4 10 8 2 0 3 4 13 1 0 2 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
18 9 1 1 14 8 1 0 1 6 1 0 1 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
151 123 135 108
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 139 95 206
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
36 249 172 60
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.95%)
Alanine (Ala, A)
n = 16 (7.02%)
Serine (Ser, S)
n = 21 (9.21%)
Threonine (Thr, T)
n = 12 (5.26%)
Cysteine (Cys, C)
n = 3 (1.32%)
Valine (Val, V)
n = 19 (8.33%)
Leucine (Leu, L)
n = 30 (13.16%)
Isoleucine (Ile, I)
n = 18 (7.89%)
Methionine (Met, M)
n = 7 (3.07%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 8 (3.51%)
Tyrosine (Tyr, Y)
n = 8 (3.51%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 13 (5.7%)
Glutamic acid (Glu, E)
n = 14 (6.14%)
Asparagine (Asn, N)
n = 5 (2.19%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 10 (4.39%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 5 (2.19%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 13 5 2 10 13 3 2 7 0 5 3 8 3 2 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 5 9 2 0 0 4 4 1 0 6 7 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 5 1 1 8 6 3 0 3 0 8 1 0 1 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 10 4 2 11 2 2 0 2 3 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
71 64 49 45
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 60 62 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
21 104 79 25
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 18 (6.92%)
Threonine (Thr, T)
n = 22 (8.46%)
Cysteine (Cys, C)
n = 1 (0.38%)
Valine (Val, V)
n = 14 (5.38%)
Leucine (Leu, L)
n = 32 (12.31%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 9 (3.46%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 24 (9.23%)
Tyrosine (Tyr, Y)
n = 10 (3.85%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 8 (3.08%)
Asparagine (Asn, N)
n = 5 (1.92%)
Glutamine (Gln, Q)
n = 6 (2.31%)
Histidine (His, H)
n = 17 (6.54%)
Lysine (Lys, K)
n = 4 (1.54%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 14 7 0 11 15 3 2 5 1 2 5 6 1 4 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 1 5 11 7 0 0 9 7 3 2 3 6 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 10 0 0 7 5 1 1 4 2 8 1 1 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 6 2 0 4 4 0 0 0 3 2 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
68 69 61 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 70 54 95
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 127 94 22
CYTB (size: 1143 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (6.05%)
Alanine (Ala, A)
n = 30 (7.89%)
Serine (Ser, S)
n = 25 (6.58%)
Threonine (Thr, T)
n = 25 (6.58%)
Cysteine (Cys, C)
n = 5 (1.32%)
Valine (Val, V)
n = 19 (5.0%)
Leucine (Leu, L)
n = 63 (16.58%)
Isoleucine (Ile, I)
n = 29 (7.63%)
Methionine (Met, M)
n = 9 (2.37%)
Proline (Pro, P)
n = 25 (6.58%)
Phenylalanine (Phe, F)
n = 31 (8.16%)
Tyrosine (Tyr, Y)
n = 13 (3.42%)
Tryptophan (Trp, W)
n = 11 (2.89%)
Aspartic acid (Asp, D)
n = 7 (1.84%)
Glutamic acid (Glu, E)
n = 7 (1.84%)
Asparagine (Asn, N)
n = 21 (5.53%)
Glutamine (Gln, Q)
n = 8 (2.11%)
Histidine (His, H)
n = 11 (2.89%)
Lysine (Lys, K)
n = 10 (2.63%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
3 26 5 6 17 33 6 1 6 2 1 8 7 3 4 27
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 5 2 20 7 1 1 8 9 5 1 11 12 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
16 5 2 2 9 11 1 0 2 2 11 1 0 3 18 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 7 0 0 7 8 2 0 2 6 0 0 0 1 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 114 96 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
49 103 78 151
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 197 128 28
ND1 (size: 978 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 14 (4.31%)
Alanine (Ala, A)
n = 30 (9.23%)
Serine (Ser, S)
n = 29 (8.92%)
Threonine (Thr, T)
n = 18 (5.54%)
Cysteine (Cys, C)
n = 2 (0.62%)
Valine (Val, V)
n = 18 (5.54%)
Leucine (Leu, L)
n = 61 (18.77%)
Isoleucine (Ile, I)
n = 23 (7.08%)
Methionine (Met, M)
n = 17 (5.23%)
Proline (Pro, P)
n = 25 (7.69%)
Phenylalanine (Phe, F)
n = 18 (5.54%)
Tyrosine (Tyr, Y)
n = 14 (4.31%)
Tryptophan (Trp, W)
n = 8 (2.46%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.38%)
Asparagine (Asn, N)
n = 10 (3.08%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 2 (0.62%)
Lysine (Lys, K)
n = 7 (2.15%)
Arginine (Arg, R)
n = 8 (2.46%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 16 11 4 17 28 7 4 3 3 2 8 7 1 4 14
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 2 2 20 8 0 1 4 3 6 4 14 7 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 7 2 2 10 10 1 0 6 1 13 2 1 2 8 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 7 4 0 4 6 1 0 1 5 2 0 1 0 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 97 82 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 96 54 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
37 146 112 31
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.19%)
Alanine (Ala, A)
n = 36 (10.43%)
Serine (Ser, S)
n = 33 (9.57%)
Threonine (Thr, T)
n = 35 (10.14%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 13 (3.77%)
Leucine (Leu, L)
n = 65 (18.84%)
Isoleucine (Ile, I)
n = 25 (7.25%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 24 (6.96%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.74%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 17 10 5 18 37 4 1 4 5 0 9 2 2 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 1 9 14 13 0 0 6 5 0 2 8 14 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 17 2 2 15 8 1 1 6 1 6 2 0 0 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 1 0 1 13 1 0 2 1 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 110 112 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 121 59 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 148 138 33
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.19%)
Alanine (Ala, A)
n = 36 (10.43%)
Serine (Ser, S)
n = 33 (9.57%)
Threonine (Thr, T)
n = 35 (10.14%)
Cysteine (Cys, C)
n = 1 (0.29%)
Valine (Val, V)
n = 13 (3.77%)
Leucine (Leu, L)
n = 65 (18.84%)
Isoleucine (Ile, I)
n = 25 (7.25%)
Methionine (Met, M)
n = 19 (5.51%)
Proline (Pro, P)
n = 24 (6.96%)
Phenylalanine (Phe, F)
n = 12 (3.48%)
Tyrosine (Tyr, Y)
n = 7 (2.03%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 6 (1.74%)
Asparagine (Asn, N)
n = 12 (3.48%)
Glutamine (Gln, Q)
n = 9 (2.61%)
Histidine (His, H)
n = 10 (2.9%)
Lysine (Lys, K)
n = 14 (4.06%)
Arginine (Arg, R)
n = 3 (0.87%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 17 10 5 18 37 4 1 4 5 0 9 2 2 2 10
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 0 1 9 14 13 0 0 6 5 0 2 8 14 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 17 2 2 15 8 1 1 6 1 6 2 0 0 12 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 5 1 0 1 13 1 0 2 1 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
67 110 112 57
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
32 121 59 134
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 148 138 33
ND4 (size: 1378 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (4.37%)
Alanine (Ala, A)
n = 31 (6.77%)
Serine (Ser, S)
n = 39 (8.52%)
Threonine (Thr, T)
n = 49 (10.7%)
Cysteine (Cys, C)
n = 3 (0.66%)
Valine (Val, V)
n = 10 (2.18%)
Leucine (Leu, L)
n = 102 (22.27%)
Isoleucine (Ile, I)
n = 40 (8.73%)
Methionine (Met, M)
n = 25 (5.46%)
Proline (Pro, P)
n = 28 (6.11%)
Phenylalanine (Phe, F)
n = 15 (3.28%)
Tyrosine (Tyr, Y)
n = 13 (2.84%)
Tryptophan (Trp, W)
n = 12 (2.62%)
Aspartic acid (Asp, D)
n = 2 (0.44%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 11 (2.4%)
Glutamine (Gln, Q)
n = 12 (2.62%)
Histidine (His, H)
n = 16 (3.49%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 11 (2.4%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 30 13 7 25 55 10 5 10 2 1 4 5 0 3 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 0 3 6 14 8 3 1 9 8 2 1 12 14 1 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 17 4 4 12 13 1 0 9 1 12 1 0 1 10 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 8 2 0 2 10 0 0 2 9 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 164 144 78
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
55 138 74 192
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
38 195 186 40
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (6.12%)
Alanine (Ala, A)
n = 8 (8.16%)
Serine (Ser, S)
n = 12 (12.24%)
Threonine (Thr, T)
n = 9 (9.18%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 4 (4.08%)
Leucine (Leu, L)
n = 18 (18.37%)
Isoleucine (Ile, I)
n = 5 (5.1%)
Methionine (Met, M)
n = 6 (6.12%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 6 (6.12%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 1 (1.02%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 2 (2.04%)
Glutamine (Gln, Q)
n = 2 (2.04%)
Histidine (His, H)
n = 6 (6.12%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 5 4 3 1 7 4 1 2 0 0 0 3 1 2 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 3 2 4 2 0 0 4 1 1 0 2 1 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 0 0 3 5 0 0 4 0 1 0 2 0 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 3 0 0 1 0 0 0 1 1 0 0 0 1 0 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
22 28 26 23
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
16 28 16 39
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
10 45 35 9
ND5 (size: 1824 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 33 (5.44%)
Alanine (Ala, A)
n = 58 (9.56%)
Serine (Ser, S)
n = 39 (6.43%)
Threonine (Thr, T)
n = 68 (11.2%)
Cysteine (Cys, C)
n = 7 (1.15%)
Valine (Val, V)
n = 20 (3.29%)
Leucine (Leu, L)
n = 108 (17.79%)
Isoleucine (Ile, I)
n = 48 (7.91%)
Methionine (Met, M)
n = 29 (4.78%)
Proline (Pro, P)
n = 31 (5.11%)
Phenylalanine (Phe, F)
n = 32 (5.27%)
Tyrosine (Tyr, Y)
n = 11 (1.81%)
Tryptophan (Trp, W)
n = 12 (1.98%)
Aspartic acid (Asp, D)
n = 6 (0.99%)
Glutamic acid (Glu, E)
n = 14 (2.31%)
Asparagine (Asn, N)
n = 25 (4.12%)
Glutamine (Gln, Q)
n = 19 (3.13%)
Histidine (His, H)
n = 15 (2.47%)
Lysine (Lys, K)
n = 23 (3.79%)
Arginine (Arg, R)
n = 9 (1.48%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 37 25 5 32 50 14 7 16 3 1 5 12 2 7 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 7 6 32 19 1 0 13 13 7 2 12 16 1 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
32 21 2 2 18 9 0 1 9 0 11 4 0 4 21 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
15 11 3 1 5 19 4 0 4 4 1 0 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
131 175 203 99
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
71 186 114 237
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
46 278 231 53
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 26 (15.03%)
Alanine (Ala, A)
n = 18 (10.4%)
Serine (Ser, S)
n = 11 (6.36%)
Threonine (Thr, T)
n = 4 (2.31%)
Cysteine (Cys, C)
n = 2 (1.16%)
Valine (Val, V)
n = 36 (20.81%)
Leucine (Leu, L)
n = 26 (15.03%)
Isoleucine (Ile, I)
n = 1 (0.58%)
Methionine (Met, M)
n = 6 (3.47%)
Proline (Pro, P)
n = 4 (2.31%)
Phenylalanine (Phe, F)
n = 14 (8.09%)
Tyrosine (Tyr, Y)
n = 7 (4.05%)
Tryptophan (Trp, W)
n = 5 (2.89%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 3 (1.73%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 6 (3.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 0 0 4 0 2 6 5 0 0 19 1 6 10 13 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 1 1 4 1 7 6 6 0 0 20 3 0 0 1 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 4 0 1 3 3 0 6 1 4 9 1 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 3 2 1 0 0 1 0 1 4 0 0 0 1 1
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 22 15 51
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 34 15 83
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
73 6 23 72
Total protein-coding genes (size: 11406 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 221 (5.82%)
Alanine (Ala, A)
n = 330 (8.68%)
Serine (Ser, S)
n = 282 (7.42%)
Threonine (Thr, T)
n = 317 (8.34%)
Cysteine (Cys, C)
n = 29 (0.76%)
Valine (Val, V)
n = 195 (5.13%)
Leucine (Leu, L)
n = 666 (17.53%)
Isoleucine (Ile, I)
n = 277 (7.29%)
Methionine (Met, M)
n = 169 (4.45%)
Proline (Pro, P)
n = 230 (6.05%)
Phenylalanine (Phe, F)
n = 221 (5.82%)
Tyrosine (Tyr, Y)
n = 107 (2.82%)
Tryptophan (Trp, W)
n = 107 (2.82%)
Aspartic acid (Asp, D)
n = 60 (1.58%)
Glutamic acid (Glu, E)
n = 96 (2.53%)
Asparagine (Asn, N)
n = 121 (3.18%)
Glutamine (Gln, Q)
n = 92 (2.42%)
Histidine (His, H)
n = 110 (2.89%)
Lysine (Lys, K)
n = 89 (2.34%)
Arginine (Arg, R)
n = 72 (1.89%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
63 214 112 46 178 310 79 39 68 24 37 59 71 28 54 167
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
57 1 28 52 173 94 11 14 79 74 54 26 92 102 10 31
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
157 113 16 23 100 87 13 7 52 19 88 19 14 16 105 10
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
100 74 22 6 54 77 12 1 16 45 10 0 2 7 1 88
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
902 1117 1034 748
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
490 1100 683 1528
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
372 1662 1361 406

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.