Viewing data for Apis mellifera


Scientific name Apis mellifera
Common name Honey bee
Maximum lifespan 8.00 years (Apis mellifera@AnAge)

Total mtDNA (size: 16343 bases) GC AT G C A T
Base content (bases) 2475 13868 1570 905 6807 7061
Base content per 1 kb (bases) 151 849 96 55 417 432
Base content (%) 15.1% 84.9%
Total protein-coding genes (size: 11048 bases) GC AT G C A T
Base content (bases) 1845 9203 1153 692 4550 4653
Base content per 1 kb (bases) 167 833 104 63 412 421
Base content (%) 16.7% 83.3%
D-loop: No data available for this section.
Total tRNA-coding genes (size: 1507 bases) GC AT G C A T
Base content (bases) 195 1312 110 85 632 680
Base content per 1 kb (bases) 129 871 73 56 419 451
Base content (%) 12.9% 87.1%
Total rRNA-coding genes (size: 2157 bases) GC AT G C A T
Base content (bases) 357 1800 245 112 884 916
Base content per 1 kb (bases) 166 834 114 52 410 425
Base content (%) 16.6% 83.4%
12S rRNA gene (size: 786 bases) GC AT G C A T
Base content (bases) 146 640 100 46 329 311
Base content per 1 kb (bases) 186 814 127 59 419 396
Base content (%) 18.6% 81.4%
16S rRNA gene (size: 1371 bases) GC AT G C A T
Base content (bases) 211 1160 145 66 555 605
Base content per 1 kb (bases) 154 846 106 48 405 441
Base content (%) 15.4% 84.6%

ATP6 (size: 681 bases) GC AT G C A T
Base content (bases) 104 577 66 38 317 260
Base content per 1 kb (bases) 153 847 97 56 465 382
Base content (%) 15.3% 84.7%
ATP8 (size: 159 bases) GC AT G C A T
Base content (bases) 17 142 12 5 68 74
Base content per 1 kb (bases) 107 893 75 31 428 465
Base content (%) 10.7% 89.3%
COX1 (size: 1566 bases) GC AT G C A T
Base content (bases) 377 1189 206 171 646 543
Base content per 1 kb (bases) 241 759 132 109 413 347
Base content (%) 24.1% 75.9%
COX2 (size: 678 bases) GC AT G C A T
Base content (bases) 132 546 77 55 281 265
Base content per 1 kb (bases) 195 805 114 81 414 391
Base content (%) 19.5% 80.5%
COX3 (size: 780 bases) GC AT G C A T
Base content (bases) 133 647 79 54 360 287
Base content per 1 kb (bases) 171 829 101 69 462 368
Base content (%) 17.1% 82.9%
CYTB (size: 1152 bases) GC AT G C A T
Base content (bases) 223 929 128 95 505 424
Base content per 1 kb (bases) 194 806 111 82 438 368
Base content (%) 19.4% 80.6%
ND1 (size: 918 bases) GC AT G C A T
Base content (bases) 156 762 106 50 311 451
Base content per 1 kb (bases) 170 830 115 54 339 491
Base content (%) 17.0% 83.0%
ND2 (size: 1002 bases) GC AT G C A T
Base content (bases) 135 867 88 47 473 394
Base content per 1 kb (bases) 135 865 88 47 472 393
Base content (%) 13.5% 86.5%
ND3 (size: 354 bases) GC AT G C A T
Base content (bases) 48 306 33 15 169 137
Base content per 1 kb (bases) 136 864 93 42 477 387
Base content (%) 13.6% 86.4%
ND4 (size: 1344 bases) GC AT G C A T
Base content (bases) 181 1163 121 60 488 675
Base content per 1 kb (bases) 135 865 90 45 363 502
Base content (%) 13.5% 86.5%
ND4L (size: 264 bases) GC AT G C A T
Base content (bases) 37 227 31 6 87 140
Base content per 1 kb (bases) 140 860 117 23 330 530
Base content (%) 14.0% 86.0%
ND5 (size: 1665 bases) GC AT G C A T
Base content (bases) 239 1426 155 84 631 795
Base content per 1 kb (bases) 144 856 93 50 379 477
Base content (%) 14.4% 85.6%
ND6 (size: 504 bases) GC AT G C A T
Base content (bases) 66 438 51 15 222 216
Base content per 1 kb (bases) 131 869 101 30 440 429
Base content (%) 13.1% 86.9%

ATP6 (size: 681 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 2 (0.88%)
Alanine (Ala, A)
n = 1 (0.44%)
Serine (Ser, S)
n = 26 (11.5%)
Threonine (Thr, T)
n = 9 (3.98%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 7 (3.1%)
Leucine (Leu, L)
n = 41 (18.14%)
Isoleucine (Ile, I)
n = 38 (16.81%)
Methionine (Met, M)
n = 21 (9.29%)
Proline (Pro, P)
n = 8 (3.54%)
Phenylalanine (Phe, F)
n = 21 (9.29%)
Tyrosine (Tyr, Y)
n = 9 (3.98%)
Tryptophan (Trp, W)
n = 4 (1.77%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 5 (2.21%)
Asparagine (Asn, N)
n = 18 (7.96%)
Glutamine (Gln, Q)
n = 4 (1.77%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 5 (2.21%)
Arginine (Arg, R)
n = 3 (1.33%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
38 0 20 6 0 3 0 30 4 0 4 0 3 0 19 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 0 0 1 0 0 0 2 0 2 0 6 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 6 0 4 0 12 0 2 0 9 0 0 2 15 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 5 0 1 0 5 0 0 0 3 0 8 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
16 27 101 83
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
19 34 46 128
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 5 113 106
ATP8 (size: 159 bases)
Amino acid sequence: IPQMMPMKWFLIYFIYLLIFYLFIMLINSMLIKTKINKETLKIKLKKWNWFW*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 1 (1.92%)
Threonine (Thr, T)
n = 2 (3.85%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 8 (15.38%)
Isoleucine (Ile, I)
n = 9 (17.31%)
Methionine (Met, M)
n = 5 (9.62%)
Proline (Pro, P)
n = 2 (3.85%)
Phenylalanine (Phe, F)
n = 5 (9.62%)
Tyrosine (Tyr, Y)
n = 3 (5.77%)
Tryptophan (Trp, W)
n = 4 (7.69%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 1 (1.92%)
Asparagine (Asn, N)
n = 3 (5.77%)
Glutamine (Gln, Q)
n = 1 (1.92%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 8 (15.38%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 2 5 0 0 1 0 7 1 0 0 0 0 0 4 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 0 0 0 0 0 0 0 0 0 0 2 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 0 0 1 0 0 0 3 0 0 0 3 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 0 0 0 8 0 0 0 0 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1 4 27 21
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
4 5 17 27
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
0 3 30 20
COX1 (size: 1566 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 37 (7.1%)
Alanine (Ala, A)
n = 16 (3.07%)
Serine (Ser, S)
n = 58 (11.13%)
Threonine (Thr, T)
n = 20 (3.84%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 19 (3.65%)
Leucine (Leu, L)
n = 73 (14.01%)
Isoleucine (Ile, I)
n = 61 (11.71%)
Methionine (Met, M)
n = 39 (7.49%)
Proline (Pro, P)
n = 26 (4.99%)
Phenylalanine (Phe, F)
n = 45 (8.64%)
Tyrosine (Tyr, Y)
n = 20 (3.84%)
Tryptophan (Trp, W)
n = 15 (2.88%)
Aspartic acid (Asp, D)
n = 14 (2.69%)
Glutamic acid (Glu, E)
n = 7 (1.34%)
Asparagine (Asn, N)
n = 25 (4.8%)
Glutamine (Gln, Q)
n = 6 (1.15%)
Histidine (His, H)
n = 17 (3.26%)
Lysine (Lys, K)
n = 15 (2.88%)
Arginine (Arg, R)
n = 7 (1.34%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
58 3 38 9 0 11 0 52 6 0 11 1 7 0 39 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 3 0 13 0 8 0 28 1 9 2 15 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 10 0 11 2 32 0 1 1 18 2 1 1 23 2 16
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 7 0 12 2 14 1 1 0 6 0 11 0 1 0 14
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
93 76 173 180
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 107 105 237
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 23 265 229
COX2 (size: 678 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 6 (2.67%)
Alanine (Ala, A)
n = 2 (0.89%)
Serine (Ser, S)
n = 19 (8.44%)
Threonine (Thr, T)
n = 10 (4.44%)
Cysteine (Cys, C)
n = 3 (1.33%)
Valine (Val, V)
n = 9 (4.0%)
Leucine (Leu, L)
n = 22 (9.78%)
Isoleucine (Ile, I)
n = 36 (16.0%)
Methionine (Met, M)
n = 13 (5.78%)
Proline (Pro, P)
n = 10 (4.44%)
Phenylalanine (Phe, F)
n = 18 (8.0%)
Tyrosine (Tyr, Y)
n = 10 (4.44%)
Tryptophan (Trp, W)
n = 6 (2.67%)
Aspartic acid (Asp, D)
n = 7 (3.11%)
Glutamic acid (Glu, E)
n = 9 (4.0%)
Asparagine (Asn, N)
n = 20 (8.89%)
Glutamine (Gln, Q)
n = 7 (3.11%)
Histidine (His, H)
n = 5 (2.22%)
Lysine (Lys, K)
n = 8 (3.56%)
Arginine (Arg, R)
n = 5 (2.22%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 2 13 0 0 4 0 18 7 0 4 0 5 0 17 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 3 0 1 0 1 0 4 0 2 0 1 0 9 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 7 0 0 2 15 0 0 0 10 0 0 0 18 2 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 9 0 7 0 8 0 3 0 2 0 2 0 1 0 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
33 31 89 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 39 67 98
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
0 7 109 110
COX3 (size: 780 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 7 (2.7%)
Alanine (Ala, A)
n = 2 (0.77%)
Serine (Ser, S)
n = 29 (11.2%)
Threonine (Thr, T)
n = 14 (5.41%)
Cysteine (Cys, C)
n = 1 (0.39%)
Valine (Val, V)
n = 7 (2.7%)
Leucine (Leu, L)
n = 32 (12.36%)
Isoleucine (Ile, I)
n = 38 (14.67%)
Methionine (Met, M)
n = 18 (6.95%)
Proline (Pro, P)
n = 8 (3.09%)
Phenylalanine (Phe, F)
n = 35 (13.51%)
Tyrosine (Tyr, Y)
n = 11 (4.25%)
Tryptophan (Trp, W)
n = 8 (3.09%)
Aspartic acid (Asp, D)
n = 3 (1.16%)
Glutamic acid (Glu, E)
n = 6 (2.32%)
Asparagine (Asn, N)
n = 19 (7.34%)
Glutamine (Gln, Q)
n = 2 (0.77%)
Histidine (His, H)
n = 9 (3.47%)
Lysine (Lys, K)
n = 7 (2.7%)
Arginine (Arg, R)
n = 3 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
36 2 17 3 1 2 0 26 2 0 3 0 4 0 34 1
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 0 0 0 2 0 3 0 4 0 2 0 6 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 12 0 3 0 17 0 2 0 9 2 0 0 19 0 9
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 6 0 2 1 7 0 0 0 3 0 7 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 28 105 102
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
28 44 58 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 7 124 128
CYTB (size: 1152 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (5.48%)
Alanine (Ala, A)
n = 12 (3.13%)
Serine (Ser, S)
n = 25 (6.53%)
Threonine (Thr, T)
n = 15 (3.92%)
Cysteine (Cys, C)
n = 2 (0.52%)
Valine (Val, V)
n = 8 (2.09%)
Leucine (Leu, L)
n = 49 (12.79%)
Isoleucine (Ile, I)
n = 49 (12.79%)
Methionine (Met, M)
n = 27 (7.05%)
Proline (Pro, P)
n = 16 (4.18%)
Phenylalanine (Phe, F)
n = 41 (10.7%)
Tyrosine (Tyr, Y)
n = 24 (6.27%)
Tryptophan (Trp, W)
n = 13 (3.39%)
Aspartic acid (Asp, D)
n = 7 (1.83%)
Glutamic acid (Glu, E)
n = 3 (0.78%)
Asparagine (Asn, N)
n = 39 (10.18%)
Glutamine (Gln, Q)
n = 4 (1.04%)
Histidine (His, H)
n = 9 (2.35%)
Lysine (Lys, K)
n = 15 (3.92%)
Arginine (Arg, R)
n = 4 (1.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
44 5 26 8 0 3 0 38 4 0 2 0 6 0 34 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 2 0 3 1 8 0 5 0 16 0 4 0 12 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 8 0 4 1 17 0 2 0 24 0 0 0 36 3 8
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 0 6 1 15 0 1 0 3 0 1 0 1 0 13
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 44 148 141
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
43 65 102 174
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 19 174 190
ND1 (size: 918 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (3.61%)
Alanine (Ala, A)
n = 4 (1.31%)
Serine (Ser, S)
n = 24 (7.87%)
Threonine (Thr, T)
n = 5 (1.64%)
Cysteine (Cys, C)
n = 4 (1.31%)
Valine (Val, V)
n = 15 (4.92%)
Leucine (Leu, L)
n = 51 (16.72%)
Isoleucine (Ile, I)
n = 35 (11.48%)
Methionine (Met, M)
n = 29 (9.51%)
Proline (Pro, P)
n = 8 (2.62%)
Phenylalanine (Phe, F)
n = 38 (12.46%)
Tyrosine (Tyr, Y)
n = 19 (6.23%)
Tryptophan (Trp, W)
n = 8 (2.62%)
Aspartic acid (Asp, D)
n = 4 (1.31%)
Glutamic acid (Glu, E)
n = 14 (4.59%)
Asparagine (Asn, N)
n = 14 (4.59%)
Glutamine (Gln, Q)
n = 3 (0.98%)
Histidine (His, H)
n = 2 (0.66%)
Lysine (Lys, K)
n = 10 (3.28%)
Arginine (Arg, R)
n = 7 (2.3%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
34 1 26 0 0 0 0 43 1 2 9 0 6 0 38 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 4 0 1 0 3 0 6 0 5 0 6 0 2 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 5 0 7 0 3 0 19 0 0 8 14 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 13 1 4 0 9 1 1 0 5 1 9 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 20 105 133
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 29 67 168
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
16 1 139 150
ND2 (size: 1002 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 2 (0.6%)
Alanine (Ala, A)
n = 5 (1.5%)
Serine (Ser, S)
n = 30 (9.01%)
Threonine (Thr, T)
n = 18 (5.41%)
Cysteine (Cys, C)
n = 1 (0.3%)
Valine (Val, V)
n = 10 (3.0%)
Leucine (Leu, L)
n = 37 (11.11%)
Isoleucine (Ile, I)
n = 46 (13.81%)
Methionine (Met, M)
n = 29 (8.71%)
Proline (Pro, P)
n = 4 (1.2%)
Phenylalanine (Phe, F)
n = 50 (15.02%)
Tyrosine (Tyr, Y)
n = 26 (7.81%)
Tryptophan (Trp, W)
n = 8 (2.4%)
Aspartic acid (Asp, D)
n = 4 (1.2%)
Glutamic acid (Glu, E)
n = 3 (0.9%)
Asparagine (Asn, N)
n = 30 (9.01%)
Glutamine (Gln, Q)
n = 5 (1.5%)
Histidine (His, H)
n = 3 (0.9%)
Lysine (Lys, K)
n = 21 (6.31%)
Arginine (Arg, R)
n = 1 (0.3%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
44 2 29 5 0 3 0 29 5 0 3 0 7 0 42 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 0 3 0 2 0 1 0 1 0 0 1 3 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 11 0 2 3 15 0 0 0 22 4 0 0 30 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 0 4 0 20 1 1 0 0 0 10 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 21 154 135
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 47 93 172
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 20 147 166
ND3 (size: 1002 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 2 (0.6%)
Alanine (Ala, A)
n = 5 (1.5%)
Serine (Ser, S)
n = 30 (9.01%)
Threonine (Thr, T)
n = 18 (5.41%)
Cysteine (Cys, C)
n = 1 (0.3%)
Valine (Val, V)
n = 10 (3.0%)
Leucine (Leu, L)
n = 37 (11.11%)
Isoleucine (Ile, I)
n = 46 (13.81%)
Methionine (Met, M)
n = 29 (8.71%)
Proline (Pro, P)
n = 4 (1.2%)
Phenylalanine (Phe, F)
n = 50 (15.02%)
Tyrosine (Tyr, Y)
n = 26 (7.81%)
Tryptophan (Trp, W)
n = 8 (2.4%)
Aspartic acid (Asp, D)
n = 4 (1.2%)
Glutamic acid (Glu, E)
n = 3 (0.9%)
Asparagine (Asn, N)
n = 30 (9.01%)
Glutamine (Gln, Q)
n = 5 (1.5%)
Histidine (His, H)
n = 3 (0.9%)
Lysine (Lys, K)
n = 21 (6.31%)
Arginine (Arg, R)
n = 1 (0.3%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
44 2 29 5 0 3 0 29 5 0 3 0 7 0 42 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 0 3 0 2 0 1 0 1 0 0 1 3 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 11 0 2 3 15 0 0 0 22 4 0 0 30 0 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 3 0 4 0 20 1 1 0 0 0 10 0 1 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
24 21 154 135
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
22 47 93 172
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
1 20 147 166
ND4 (size: 1344 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (4.92%)
Alanine (Ala, A)
n = 4 (0.89%)
Serine (Ser, S)
n = 38 (8.5%)
Threonine (Thr, T)
n = 4 (0.89%)
Cysteine (Cys, C)
n = 5 (1.12%)
Valine (Val, V)
n = 14 (3.13%)
Leucine (Leu, L)
n = 96 (21.48%)
Isoleucine (Ile, I)
n = 57 (12.75%)
Methionine (Met, M)
n = 52 (11.63%)
Proline (Pro, P)
n = 6 (1.34%)
Phenylalanine (Phe, F)
n = 39 (8.72%)
Tyrosine (Tyr, Y)
n = 29 (6.49%)
Tryptophan (Trp, W)
n = 9 (2.01%)
Aspartic acid (Asp, D)
n = 3 (0.67%)
Glutamic acid (Glu, E)
n = 7 (1.57%)
Asparagine (Asn, N)
n = 34 (7.61%)
Glutamine (Gln, Q)
n = 3 (0.67%)
Histidine (His, H)
n = 6 (1.34%)
Lysine (Lys, K)
n = 16 (3.58%)
Arginine (Arg, R)
n = 3 (0.67%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
57 0 46 1 0 0 0 88 3 0 10 0 4 0 39 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 5 0 3 0 1 0 6 0 14 2 4 0 2 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 11 0 14 1 2 1 29 0 2 7 34 0 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 5 2 3 0 16 0 0 0 3 0 9 0 1 0 7
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
50 19 175 204
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
51 40 99 258
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 1 214 213
ND4L (size: 264 bases)
Amino acid sequence: IKLLFVMMLLFFMFLWYYNVNFLSFLILMEFLVITVLFFIIGYEINSWLFLIFLVFSVCELVLGLSLLVSMNYELGHQKLSVMDLIY*
Amino acid frequencies:
Glycine (Gly, G)
n = 3 (3.45%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 6 (6.9%)
Threonine (Thr, T)
n = 1 (1.15%)
Cysteine (Cys, C)
n = 1 (1.15%)
Valine (Val, V)
n = 9 (10.34%)
Leucine (Leu, L)
n = 21 (24.14%)
Isoleucine (Ile, I)
n = 8 (9.2%)
Methionine (Met, M)
n = 6 (6.9%)
Proline (Pro, P)
n = 0 (0%)
Phenylalanine (Phe, F)
n = 12 (13.79%)
Tyrosine (Tyr, Y)
n = 5 (5.75%)
Tryptophan (Trp, W)
n = 2 (2.3%)
Aspartic acid (Asp, D)
n = 1 (1.15%)
Glutamic acid (Glu, E)
n = 4 (4.6%)
Asparagine (Asn, N)
n = 4 (4.6%)
Glutamine (Gln, Q)
n = 1 (1.15%)
Histidine (His, H)
n = 1 (1.15%)
Lysine (Lys, K)
n = 2 (2.3%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
8 0 6 1 0 0 0 19 1 0 3 0 6 0 12 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 0 0 0 0 0 2 0 1 0 0 0 0 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 1 0 1 0 1 0 5 0 2 1 4 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 1 1 0 2 0 0 0 0 0 3 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
17 3 25 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 3 19 56
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 0 43 41
ND5 (size: 1665 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (3.97%)
Alanine (Ala, A)
n = 10 (1.81%)
Serine (Ser, S)
n = 51 (9.21%)
Threonine (Thr, T)
n = 18 (3.25%)
Cysteine (Cys, C)
n = 5 (0.9%)
Valine (Val, V)
n = 21 (3.79%)
Leucine (Leu, L)
n = 89 (16.06%)
Isoleucine (Ile, I)
n = 73 (13.18%)
Methionine (Met, M)
n = 66 (11.91%)
Proline (Pro, P)
n = 7 (1.26%)
Phenylalanine (Phe, F)
n = 49 (8.84%)
Tyrosine (Tyr, Y)
n = 46 (8.3%)
Tryptophan (Trp, W)
n = 4 (0.72%)
Aspartic acid (Asp, D)
n = 10 (1.81%)
Glutamic acid (Glu, E)
n = 13 (2.35%)
Asparagine (Asn, N)
n = 27 (4.87%)
Glutamine (Gln, Q)
n = 3 (0.54%)
Histidine (His, H)
n = 4 (0.72%)
Lysine (Lys, K)
n = 31 (5.6%)
Arginine (Arg, R)
n = 5 (0.9%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
73 0 57 1 0 0 0 83 3 0 16 0 5 0 49 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 5 0 6 0 4 0 12 0 10 0 3 0 4 0 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 5 1 7 1 20 0 4 0 46 0 0 5 27 0 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 12 1 10 0 29 2 1 0 4 0 17 2 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
76 20 238 221
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
59 63 135 298
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
20 1 258 276
ND6 (size: 504 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (0.6%)
Alanine (Ala, A)
n = 0 (0%)
Serine (Ser, S)
n = 16 (9.58%)
Threonine (Thr, T)
n = 10 (5.99%)
Cysteine (Cys, C)
n = 1 (0.6%)
Valine (Val, V)
n = 1 (0.6%)
Leucine (Leu, L)
n = 29 (17.37%)
Isoleucine (Ile, I)
n = 30 (17.96%)
Methionine (Met, M)
n = 21 (12.57%)
Proline (Pro, P)
n = 3 (1.8%)
Phenylalanine (Phe, F)
n = 12 (7.19%)
Tyrosine (Tyr, Y)
n = 11 (6.59%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 1 (0.6%)
Glutamic acid (Glu, E)
n = 3 (1.8%)
Asparagine (Asn, N)
n = 10 (5.99%)
Glutamine (Gln, Q)
n = 2 (1.2%)
Histidine (His, H)
n = 1 (0.6%)
Lysine (Lys, K)
n = 14 (8.38%)
Arginine (Arg, R)
n = 1 (0.6%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
25 5 21 0 0 6 0 23 2 0 1 0 0 0 12 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
0 1 0 0 0 0 0 0 0 1 0 2 0 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 6 0 4 2 7 0 0 0 9 2 0 0 9 1 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 3 0 1 0 11 3 1 0 0 0 3 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
6 13 88 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 26 43 93
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 12 85 68
Total protein-coding genes (size: 11067 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 135 (3.66%)
Alanine (Ala, A)
n = 57 (1.55%)
Serine (Ser, S)
n = 334 (9.06%)
Threonine (Thr, T)
n = 131 (3.55%)
Cysteine (Cys, C)
n = 25 (0.68%)
Valine (Val, V)
n = 121 (3.28%)
Leucine (Leu, L)
n = 568 (15.4%)
Isoleucine (Ile, I)
n = 500 (13.56%)
Methionine (Met, M)
n = 334 (9.06%)
Proline (Pro, P)
n = 103 (2.79%)
Phenylalanine (Phe, F)
n = 381 (10.33%)
Tyrosine (Tyr, Y)
n = 219 (5.94%)
Tryptophan (Trp, W)
n = 83 (2.25%)
Aspartic acid (Asp, D)
n = 57 (1.55%)
Glutamic acid (Glu, E)
n = 79 (2.14%)
Asparagine (Asn, N)
n = 249 (6.75%)
Glutamine (Gln, Q)
n = 41 (1.11%)
Histidine (His, H)
n = 60 (1.63%)
Lysine (Lys, K)
n = 160 (4.34%)
Arginine (Arg, R)
n = 39 (1.06%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
476 24 312 35 1 36 0 472 39 2 67 1 53 0 355 26
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
22 25 0 20 1 36 0 47 0 85 3 36 3 64 0 53
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 72 1 53 11 166 1 18 2 209 10 5 24 238 11 57
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 74 5 52 5 152 8 9 0 29 1 81 2 13 0 78
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
449 315 1477 1448
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
385 522 878 1904
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
74 103 1762 1750

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.