Viewing data for Clupea pallasii


Scientific name Clupea pallasii
Common name Pacific herring
Maximum lifespan 19.00 years (Clupea pallasii@AnAge)

Total mtDNA (size: 16700 bases) GC AT G C A T
Base content (bases) 7911 8789 4714 3197 4296 4493
Base content per 1 kb (bases) 474 526 282 191 257 269
Base content (%) 47.4% 52.6%
Total protein-coding genes (size: 11403 bases) GC AT G C A T
Base content (bases) 5433 5970 3348 2085 3101 2869
Base content per 1 kb (bases) 476 524 294 183 272 252
Base content (%) 47.6% 52.4%
D-loop (size: 1047 bases) GC AT G C A T
Base content (bases) 409 638 230 179 321 317
Base content per 1 kb (bases) 391 609 220 171 307 303
Base content (%) 39.1% 60.9%
Total tRNA-coding genes (size: 1550 bases) GC AT G C A T
Base content (bases) 758 792 413 345 355 437
Base content per 1 kb (bases) 489 511 266 223 229 282
Base content (%) 48.9% 51.1%
Total rRNA-coding genes (size: 2638 bases) GC AT G C A T
Base content (bases) 1277 1361 700 577 507 854
Base content per 1 kb (bases) 484 516 265 219 192 324
Base content (%) 48.4% 51.6%
12S rRNA gene (size: 953 bases) GC AT G C A T
Base content (bases) 479 474 262 217 186 288
Base content per 1 kb (bases) 503 497 275 228 195 302
Base content (%) 50.3% 49.7%
16S rRNA gene (size: 1685 bases) GC AT G C A T
Base content (bases) 798 887 438 360 321 566
Base content per 1 kb (bases) 474 526 260 214 191 336
Base content (%) 47.4% 52.6%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 315 368 213 102 198 170
Base content per 1 kb (bases) 461 539 312 149 290 249
Base content (%) 46.1% 53.9%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 71 97 48 23 46 51
Base content per 1 kb (bases) 423 577 286 137 274 304
Base content (%) 42.3% 57.7%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 715 836 412 303 448 388
Base content per 1 kb (bases) 461 539 266 195 289 250
Base content (%) 46.1% 53.9%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 311 380 186 125 185 195
Base content per 1 kb (bases) 450 550 269 181 268 282
Base content (%) 45.0% 55.0%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 383 402 229 154 214 188
Base content per 1 kb (bases) 488 512 292 196 273 239
Base content (%) 48.8% 51.2%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 529 612 318 211 334 278
Base content per 1 kb (bases) 464 536 279 185 293 244
Base content (%) 46.4% 53.6%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 484 491 290 194 283 208
Base content per 1 kb (bases) 496 504 297 199 290 213
Base content (%) 49.6% 50.4%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 523 522 340 183 274 248
Base content per 1 kb (bases) 500 500 325 175 262 237
Base content (%) 50.0% 50.0%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 163 186 97 66 107 79
Base content per 1 kb (bases) 467 533 278 189 307 226
Base content (%) 46.7% 53.3%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 685 696 420 265 360 336
Base content per 1 kb (bases) 496 504 304 192 261 243
Base content (%) 49.6% 50.4%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 144 153 95 49 81 72
Base content per 1 kb (bases) 485 515 320 165 273 242
Base content (%) 48.5% 51.5%
ND5 (size: 1836 bases) GC AT G C A T
Base content (bases) 854 982 535 319 497 485
Base content per 1 kb (bases) 465 535 291 174 271 264
Base content (%) 46.5% 53.5%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 262 260 168 94 80 180
Base content per 1 kb (bases) 502 498 322 180 153 345
Base content (%) 50.2% 49.8%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 8 (3.54%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 16 (7.08%)
Leucine (Leu, L)
n = 51 (22.57%)
Isoleucine (Ile, I)
n = 17 (7.52%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 18 (7.96%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 5 (2.21%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 8 (3.54%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 6 3 17 8 13 5 7 5 4 5 6 4 1 7 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 0 2 6 9 2 2 4 4 1 2 9 7 0 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 7 0 0 0 3 0 0 5 1 4 1 1 3 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 3 1 0 1 1 0 0 2 4 0 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 79 64 33
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 62 31 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
24 72 74 57
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFAILVFSWVVFLTIIPQKILAHNFNNEPTTMGAEKAKPEPWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 1 (1.82%)
Threonine (Thr, T)
n = 3 (5.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 0 1 0 0 1 2 2 0 2 0 1 0 0 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 0 4 1 0 0 0 0 1 3 4 1 0 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 0 1 0 0 0 0 0 0 1 0 0 3 2 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 1 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
12 13 17 14
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 17 16 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 18 18 15
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.91%)
Alanine (Ala, A)
n = 47 (9.11%)
Serine (Ser, S)
n = 30 (5.81%)
Threonine (Thr, T)
n = 36 (6.98%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 41 (7.95%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 40 (7.75%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 12 6 21 6 27 6 2 7 1 13 4 16 8 14 28
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
18 0 1 5 21 18 3 6 3 22 15 10 8 8 2 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
12 12 3 3 8 12 2 1 4 4 14 2 1 7 7 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
16 8 3 5 9 7 2 2 0 5 1 0 0 1 0 15
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
159 123 128 107
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 136 94 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
67 153 166 131
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 15 (6.55%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 9 (3.93%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 23 (10.04%)
Leucine (Leu, L)
n = 30 (13.1%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 7 (3.06%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 8 (3.49%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 5 7 7 7 9 1 4 7 1 3 7 11 2 1 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 1 1 2 6 4 3 1 0 5 3 4 4 4 2 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
1 5 1 6 4 4 0 0 3 4 5 1 2 1 4 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 11 3 4 9 3 1 0 2 3 1 0 0 0 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 62 51 43
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 52 63 90
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 72 81 51
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 23 (8.85%)
Alanine (Ala, A)
n = 23 (8.85%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 23 (8.85%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 21 (8.08%)
Leucine (Leu, L)
n = 30 (11.54%)
Isoleucine (Ile, I)
n = 11 (4.23%)
Methionine (Met, M)
n = 6 (2.31%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 1 (0.38%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
5 6 2 5 3 11 4 5 5 3 6 4 10 1 9 16
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 2 10 11 0 3 6 8 6 5 3 3 1 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 6 1 2 3 5 2 0 3 4 8 2 2 0 1 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 2 3 2 2 0 0 2 3 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
81 64 46 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
45 70 53 93
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 95 88 50
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (7.12%)
Alanine (Ala, A)
n = 37 (9.76%)
Serine (Ser, S)
n = 25 (6.6%)
Threonine (Thr, T)
n = 20 (5.28%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 27 (7.12%)
Leucine (Leu, L)
n = 59 (15.57%)
Isoleucine (Ile, I)
n = 25 (6.6%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 31 (8.18%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 12 (3.17%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 7 4 13 9 15 11 10 4 2 7 8 7 5 9 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 0 3 8 12 16 1 1 2 14 10 4 5 5 7 7
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 6 1 4 7 10 2 0 2 3 11 1 1 2 16 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 4 1 6 4 6 3 0 0 7 1 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
106 95 85 94
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
52 101 74 153
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
53 122 119 86
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (5.25%)
Alanine (Ala, A)
n = 37 (11.42%)
Serine (Ser, S)
n = 23 (7.1%)
Threonine (Thr, T)
n = 22 (6.79%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 17 (5.25%)
Leucine (Leu, L)
n = 60 (18.52%)
Isoleucine (Ile, I)
n = 19 (5.86%)
Methionine (Met, M)
n = 15 (4.63%)
Proline (Pro, P)
n = 23 (7.1%)
Phenylalanine (Phe, F)
n = 20 (6.17%)
Tyrosine (Tyr, Y)
n = 11 (3.4%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 10 (3.09%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 4 3 13 7 15 12 11 3 3 2 7 5 3 8 12
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 0 1 8 12 7 10 3 6 1 7 6 13 1 3 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
9 5 2 4 9 3 3 1 3 5 6 2 2 6 4 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 8 3 1 3 4 3 0 0 4 4 0 0 0 1 6
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 89 77 73
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
38 101 55 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
70 100 76 79
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 41 (11.82%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 3 (0.86%)
Valine (Val, V)
n = 15 (4.32%)
Leucine (Leu, L)
n = 66 (19.02%)
Isoleucine (Ile, I)
n = 20 (5.76%)
Methionine (Met, M)
n = 18 (5.19%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 13 (3.75%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 7 6 12 16 15 14 6 7 6 6 4 4 1 6 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 1 2 4 19 11 7 0 3 7 6 7 8 5 1 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 10 5 7 7 2 2 0 5 4 5 2 3 5 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 2 2 0 5 3 3 0 1 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 102 107 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 127 51 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
65 111 90 82
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 41 (11.82%)
Serine (Ser, S)
n = 23 (6.63%)
Threonine (Thr, T)
n = 47 (13.54%)
Cysteine (Cys, C)
n = 3 (0.86%)
Valine (Val, V)
n = 15 (4.32%)
Leucine (Leu, L)
n = 66 (19.02%)
Isoleucine (Ile, I)
n = 20 (5.76%)
Methionine (Met, M)
n = 18 (5.19%)
Proline (Pro, P)
n = 21 (6.05%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 9 (2.59%)
Glutamine (Gln, Q)
n = 13 (3.75%)
Histidine (His, H)
n = 6 (1.73%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
13 7 6 12 16 15 14 6 7 6 6 4 4 1 6 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
12 1 2 4 19 11 7 0 3 7 6 7 8 5 1 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 10 5 7 7 2 2 0 5 4 5 2 3 5 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 2 2 2 0 5 3 3 0 1 1 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
78 102 107 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
40 127 51 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
65 111 90 82
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 28 (6.1%)
Alanine (Ala, A)
n = 43 (9.37%)
Serine (Ser, S)
n = 26 (5.66%)
Threonine (Thr, T)
n = 41 (8.93%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 19 (4.14%)
Leucine (Leu, L)
n = 88 (19.17%)
Isoleucine (Ile, I)
n = 37 (8.06%)
Methionine (Met, M)
n = 24 (5.23%)
Proline (Pro, P)
n = 28 (6.1%)
Phenylalanine (Phe, F)
n = 17 (3.7%)
Tyrosine (Tyr, Y)
n = 13 (2.83%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 13 (2.83%)
Glutamine (Gln, Q)
n = 9 (1.96%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
22 15 10 17 17 25 16 10 2 7 3 6 8 2 6 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
14 1 4 7 20 12 4 3 5 9 11 6 14 5 3 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 12 6 3 8 2 5 2 6 5 8 8 3 4 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 8 4 1 3 9 1 1 2 7 2 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
106 135 133 86
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
73 130 72 185
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
86 155 131 88
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 12 (12.24%)
Serine (Ser, S)
n = 6 (6.12%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 4 (4.08%)
Glutamine (Gln, Q)
n = 5 (5.1%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 3 2 7 9 0 1 5 0 1 1 2 1 4 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 2 1 3 5 3 1 0 4 1 0 0 0 2 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 1 1 3 0 0 1 1 0 0 1 3 2 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 2 1 0 0 0 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 31 23 20
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 29 16 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 35 33 20
ND5 (size: 1836 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.07%)
Alanine (Ala, A)
n = 60 (9.82%)
Serine (Ser, S)
n = 43 (7.04%)
Threonine (Thr, T)
n = 61 (9.98%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 32 (5.24%)
Leucine (Leu, L)
n = 86 (14.08%)
Isoleucine (Ile, I)
n = 50 (8.18%)
Methionine (Met, M)
n = 31 (5.07%)
Proline (Pro, P)
n = 29 (4.75%)
Phenylalanine (Phe, F)
n = 39 (6.38%)
Tyrosine (Tyr, Y)
n = 12 (1.96%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 13 (2.13%)
Glutamic acid (Glu, E)
n = 10 (1.64%)
Asparagine (Asn, N)
n = 30 (4.91%)
Glutamine (Gln, Q)
n = 20 (3.27%)
Histidine (His, H)
n = 14 (2.29%)
Lysine (Lys, K)
n = 20 (3.27%)
Arginine (Arg, R)
n = 10 (1.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
28 22 15 15 15 30 16 9 9 11 11 9 5 7 19 20
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
16 2 4 8 26 22 4 7 8 4 12 8 14 7 0 14
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
25 12 10 6 10 11 3 4 9 6 6 2 1 11 19 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 7 3 5 8 10 10 0 0 7 3 0 0 0 1 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
146 149 205 112
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 180 120 238
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
99 206 160 147
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 21 (12.14%)
Alanine (Ala, A)
n = 21 (12.14%)
Serine (Ser, S)
n = 7 (4.05%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 4 (2.31%)
Valine (Val, V)
n = 26 (15.03%)
Leucine (Leu, L)
n = 28 (16.18%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 8 (4.62%)
Proline (Pro, P)
n = 6 (3.47%)
Phenylalanine (Phe, F)
n = 17 (9.83%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 3 (1.73%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 2 (1.16%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 2 (1.16%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 1 1 1 7 6 8 1 0 8 3 6 9 9 8
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 3 1 7 6 6 2 5 1 1 14 4 2 0 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 5 2 0 0 1 1 3 5 3 0 5 2 0 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 1 3 1 2 0 2 0 1 1 2 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 27 23 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
36 35 22 81
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
57 32 35 50
Total protein-coding genes (size: 11424 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 241 (6.34%)
Alanine (Ala, A)
n = 370 (9.73%)
Serine (Ser, S)
n = 230 (6.05%)
Threonine (Thr, T)
n = 303 (7.97%)
Cysteine (Cys, C)
n = 31 (0.81%)
Valine (Val, V)
n = 255 (6.7%)
Leucine (Leu, L)
n = 612 (16.09%)
Isoleucine (Ile, I)
n = 253 (6.65%)
Methionine (Met, M)
n = 172 (4.52%)
Proline (Pro, P)
n = 219 (5.76%)
Phenylalanine (Phe, F)
n = 239 (6.28%)
Tyrosine (Tyr, Y)
n = 115 (3.02%)
Tryptophan (Trp, W)
n = 118 (3.1%)
Aspartic acid (Asp, D)
n = 73 (1.92%)
Glutamic acid (Glu, E)
n = 96 (2.52%)
Asparagine (Asn, N)
n = 120 (3.15%)
Glutamine (Gln, Q)
n = 98 (2.58%)
Histidine (His, H)
n = 101 (2.66%)
Lysine (Lys, K)
n = 76 (2.0%)
Arginine (Arg, R)
n = 77 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
160 93 63 130 99 182 96 79 59 39 69 60 83 43 97 142
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
109 11 20 57 153 123 37 32 45 78 86 60 89 49 21 70
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
118 80 35 40 62 53 20 10 45 43 72 22 26 47 73 19
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
82 68 28 28 45 51 25 7 10 45 15 0 0 3 3 96
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1035 1002 979 789
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
522 1067 685 1531
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
605 1208 1112 880

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.