Viewing data for Apalone spinifera


Scientific name Apalone spinifera
Common name Spiny softshell turtle
Maximum lifespan 25.20 years (Apalone spinifera@AnAge)

Total mtDNA (size: 16749 bases) GC AT G C A T
Base content (bases) 6568 10181 4543 2025 4231 5950
Base content per 1 kb (bases) 392 608 271 121 253 355
Base content (%) 39.2% 60.8%
Total protein-coding genes (size: 11318 bases) GC AT G C A T
Base content (bases) 4578 6740 3321 1257 2814 3926
Base content per 1 kb (bases) 404 596 293 111 249 347
Base content (%) 40.4% 59.6%
D-loop (size: 1234 bases) GC AT G C A T
Base content (bases) 378 856 264 114 446 410
Base content per 1 kb (bases) 306 694 214 92 361 332
Base content (%) 30.6% 69.4%
Total tRNA-coding genes (size: 1545 bases) GC AT G C A T
Base content (bases) 588 957 354 234 414 543
Base content per 1 kb (bases) 381 619 229 151 268 351
Base content (%) 38.1% 61.9%
Total rRNA-coding genes (size: 2584 bases) GC AT G C A T
Base content (bases) 1004 1580 589 415 544 1036
Base content per 1 kb (bases) 389 611 228 161 211 401
Base content (%) 38.9% 61.1%
12S rRNA gene (size: 970 bases) GC AT G C A T
Base content (bases) 391 579 230 161 206 373
Base content per 1 kb (bases) 403 597 237 166 212 385
Base content (%) 40.3% 59.7%
16S rRNA gene (size: 1614 bases) GC AT G C A T
Base content (bases) 613 1001 359 254 338 663
Base content per 1 kb (bases) 380 620 222 157 209 411
Base content (%) 38.0% 62.0%

ATP6 (size: 684 bases) GC AT G C A T
Base content (bases) 283 401 219 64 162 239
Base content per 1 kb (bases) 414 586 320 94 237 349
Base content (%) 41.4% 58.6%
ATP8 (size: 165 bases) GC AT G C A T
Base content (bases) 55 110 45 10 40 70
Base content per 1 kb (bases) 333 667 273 61 242 424
Base content (%) 33.3% 66.7%
COX1 (size: 1545 bases) GC AT G C A T
Base content (bases) 662 883 401 261 432 451
Base content per 1 kb (bases) 428 572 260 169 280 292
Base content (%) 42.8% 57.2%
COX2 (size: 687 bases) GC AT G C A T
Base content (bases) 265 422 179 86 172 250
Base content per 1 kb (bases) 386 614 261 125 250 364
Base content (%) 38.6% 61.4%
COX3 (size: 784 bases) GC AT G C A T
Base content (bases) 340 444 223 117 196 248
Base content per 1 kb (bases) 434 566 284 149 250 316
Base content (%) 43.4% 56.6%
CYTB (size: 1131 bases) GC AT G C A T
Base content (bases) 465 666 330 135 303 363
Base content per 1 kb (bases) 411 589 292 119 268 321
Base content (%) 41.1% 58.9%
ND1 (size: 971 bases) GC AT G C A T
Base content (bases) 397 574 290 107 259 315
Base content per 1 kb (bases) 409 591 299 110 267 324
Base content (%) 40.9% 59.1%
ND2 (size: 1039 bases) GC AT G C A T
Base content (bases) 394 645 309 85 247 398
Base content per 1 kb (bases) 379 621 297 82 238 383
Base content (%) 37.9% 62.1%
ND3 (size: 350 bases) GC AT G C A T
Base content (bases) 133 217 99 34 96 121
Base content per 1 kb (bases) 380 620 283 97 274 346
Base content (%) 38.0% 62.0%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 541 840 415 126 338 502
Base content per 1 kb (bases) 392 608 301 91 245 364
Base content (%) 39.2% 60.8%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 121 176 96 25 79 97
Base content per 1 kb (bases) 407 593 323 84 266 327
Base content (%) 40.7% 59.3%
ND5 (size: 1779 bases) GC AT G C A T
Base content (bases) 724 1055 548 176 428 627
Base content per 1 kb (bases) 407 593 308 99 241 352
Base content (%) 40.7% 59.3%
ND6 (size: 528 bases) GC AT G C A T
Base content (bases) 203 325 170 33 69 256
Base content per 1 kb (bases) 384 616 322 63 131 485
Base content (%) 38.4% 61.6%

ATP6 (size: 684 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.52%)
Alanine (Ala, A)
n = 12 (5.29%)
Serine (Ser, S)
n = 14 (6.17%)
Threonine (Thr, T)
n = 27 (11.89%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 6 (2.64%)
Leucine (Leu, L)
n = 54 (23.79%)
Isoleucine (Ile, I)
n = 23 (10.13%)
Methionine (Met, M)
n = 15 (6.61%)
Proline (Pro, P)
n = 17 (7.49%)
Phenylalanine (Phe, F)
n = 5 (2.2%)
Tyrosine (Tyr, Y)
n = 3 (1.32%)
Tryptophan (Trp, W)
n = 5 (2.2%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.76%)
Asparagine (Asn, N)
n = 11 (4.85%)
Glutamine (Gln, Q)
n = 11 (4.85%)
Histidine (His, H)
n = 3 (1.32%)
Lysine (Lys, K)
n = 3 (1.32%)
Arginine (Arg, R)
n = 5 (2.2%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 17 12 1 7 33 4 8 11 0 1 1 4 0 2 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 0 0 2 6 4 0 0 2 4 2 3 4 10 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 13 0 1 4 5 1 0 3 0 3 1 1 4 7 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 1 3 0 0 1 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
31 81 82 34
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
21 67 37 103
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 71 120 25
ATP8 (size: 165 bases)
Amino acid sequence: MPQLNPNPWLSILLMTWLAYIAIYQPKITTFLQTNSITHNYKYSNTNPWNWPWI*
Amino acid frequencies:
Glycine (Gly, G)
n = 0 (0%)
Alanine (Ala, A)
n = 2 (3.7%)
Serine (Ser, S)
n = 3 (5.56%)
Threonine (Thr, T)
n = 6 (11.11%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 0 (0%)
Leucine (Leu, L)
n = 6 (11.11%)
Isoleucine (Ile, I)
n = 6 (11.11%)
Methionine (Met, M)
n = 2 (3.7%)
Proline (Pro, P)
n = 6 (11.11%)
Phenylalanine (Phe, F)
n = 1 (1.85%)
Tyrosine (Tyr, Y)
n = 4 (7.41%)
Tryptophan (Trp, W)
n = 5 (9.26%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 0 (0%)
Asparagine (Asn, N)
n = 7 (12.96%)
Glutamine (Gln, Q)
n = 3 (5.56%)
Histidine (His, H)
n = 1 (1.85%)
Lysine (Lys, K)
n = 2 (3.7%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 4 0 0 0 3 0 3 3 0 0 0 0 0 1 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 0 0 1 0 1 0 0 0 0 0 1 1 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 5 0 0 1 1 0 0 1 1 3 0 0 2 5 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 0 0 0 2 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
2 13 24 16
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 16 18 15
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
2 16 28 9
COX1 (size: 1545 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.95%)
Alanine (Ala, A)
n = 41 (7.98%)
Serine (Ser, S)
n = 35 (6.81%)
Threonine (Thr, T)
n = 40 (7.78%)
Cysteine (Cys, C)
n = 2 (0.39%)
Valine (Val, V)
n = 37 (7.2%)
Leucine (Leu, L)
n = 61 (11.87%)
Isoleucine (Ile, I)
n = 37 (7.2%)
Methionine (Met, M)
n = 31 (6.03%)
Proline (Pro, P)
n = 27 (5.25%)
Phenylalanine (Phe, F)
n = 38 (7.39%)
Tyrosine (Tyr, Y)
n = 17 (3.31%)
Tryptophan (Trp, W)
n = 17 (3.31%)
Aspartic acid (Asp, D)
n = 14 (2.72%)
Glutamic acid (Glu, E)
n = 9 (1.75%)
Asparagine (Asn, N)
n = 16 (3.11%)
Glutamine (Gln, Q)
n = 8 (1.56%)
Histidine (His, H)
n = 20 (3.89%)
Lysine (Lys, K)
n = 9 (1.75%)
Arginine (Arg, R)
n = 9 (1.75%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 20 24 4 7 22 8 18 8 0 4 7 22 4 13 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 2 0 11 15 15 0 11 12 14 9 4 8 14 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
13 19 0 4 4 20 1 0 6 5 12 1 2 3 13 11
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
9 9 0 6 8 9 0 2 0 7 0 1 0 0 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
147 105 140 123
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
81 137 93 204
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
33 159 218 105
COX2 (size: 687 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 8 (3.51%)
Alanine (Ala, A)
n = 10 (4.39%)
Serine (Ser, S)
n = 14 (6.14%)
Threonine (Thr, T)
n = 19 (8.33%)
Cysteine (Cys, C)
n = 2 (0.88%)
Valine (Val, V)
n = 12 (5.26%)
Leucine (Leu, L)
n = 27 (11.84%)
Isoleucine (Ile, I)
n = 21 (9.21%)
Methionine (Met, M)
n = 18 (7.89%)
Proline (Pro, P)
n = 14 (6.14%)
Phenylalanine (Phe, F)
n = 9 (3.95%)
Tyrosine (Tyr, Y)
n = 9 (3.95%)
Tryptophan (Trp, W)
n = 5 (2.19%)
Aspartic acid (Asp, D)
n = 9 (3.95%)
Glutamic acid (Glu, E)
n = 15 (6.58%)
Asparagine (Asn, N)
n = 8 (3.51%)
Glutamine (Gln, Q)
n = 7 (3.07%)
Histidine (His, H)
n = 11 (4.82%)
Lysine (Lys, K)
n = 4 (1.75%)
Arginine (Arg, R)
n = 6 (2.63%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 15 17 2 2 10 2 11 7 0 2 2 7 1 3 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 2 0 5 5 0 2 1 3 2 0 3 11 0 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 8 0 0 3 8 1 0 2 4 5 1 0 1 7 6
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
5 15 0 3 6 3 1 1 1 4 0 0 0 1 0 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
54 54 72 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
23 55 64 87
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
9 70 114 36
COX3 (size: 784 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 19 (7.31%)
Alanine (Ala, A)
n = 24 (9.23%)
Serine (Ser, S)
n = 13 (5.0%)
Threonine (Thr, T)
n = 26 (10.0%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 16 (6.15%)
Leucine (Leu, L)
n = 31 (11.92%)
Isoleucine (Ile, I)
n = 16 (6.15%)
Methionine (Met, M)
n = 12 (4.62%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 22 (8.46%)
Tyrosine (Tyr, Y)
n = 11 (4.23%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 4 (1.54%)
Glutamic acid (Glu, E)
n = 7 (2.69%)
Asparagine (Asn, N)
n = 4 (1.54%)
Glutamine (Gln, Q)
n = 7 (2.69%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
6 10 11 0 2 22 2 5 7 0 3 3 9 1 5 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 1 3 11 10 0 2 8 9 0 1 0 11 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 17 0 1 1 7 0 1 3 6 5 0 0 1 3 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 7 0 2 2 2 0 0 0 4 1 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
70 66 64 61
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
42 71 51 97
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
5 86 133 37
CYTB (size: 1131 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (6.65%)
Alanine (Ala, A)
n = 22 (5.85%)
Serine (Ser, S)
n = 26 (6.91%)
Threonine (Thr, T)
n = 29 (7.71%)
Cysteine (Cys, C)
n = 2 (0.53%)
Valine (Val, V)
n = 15 (3.99%)
Leucine (Leu, L)
n = 56 (14.89%)
Isoleucine (Ile, I)
n = 36 (9.57%)
Methionine (Met, M)
n = 19 (5.05%)
Proline (Pro, P)
n = 23 (6.12%)
Phenylalanine (Phe, F)
n = 26 (6.91%)
Tyrosine (Tyr, Y)
n = 15 (3.99%)
Tryptophan (Trp, W)
n = 11 (2.93%)
Aspartic acid (Asp, D)
n = 7 (1.86%)
Glutamic acid (Glu, E)
n = 4 (1.06%)
Asparagine (Asn, N)
n = 23 (6.12%)
Glutamine (Gln, Q)
n = 9 (2.39%)
Histidine (His, H)
n = 11 (2.93%)
Lysine (Lys, K)
n = 9 (2.39%)
Arginine (Arg, R)
n = 8 (2.13%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
11 25 15 7 9 29 1 10 8 1 1 2 11 1 5 21
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 1 1 4 11 7 0 1 7 13 4 2 5 14 2 3
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
10 16 0 5 6 14 0 1 0 5 10 0 0 10 13 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
8 3 1 2 5 9 0 0 1 6 1 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 97 117 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
47 99 79 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
15 134 167 61
ND1 (size: 971 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.97%)
Alanine (Ala, A)
n = 20 (6.21%)
Serine (Ser, S)
n = 26 (8.07%)
Threonine (Thr, T)
n = 24 (7.45%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 10 (3.11%)
Leucine (Leu, L)
n = 58 (18.01%)
Isoleucine (Ile, I)
n = 24 (7.45%)
Methionine (Met, M)
n = 25 (7.76%)
Proline (Pro, P)
n = 24 (7.45%)
Phenylalanine (Phe, F)
n = 22 (6.83%)
Tyrosine (Tyr, Y)
n = 13 (4.04%)
Tryptophan (Trp, W)
n = 9 (2.8%)
Aspartic acid (Asp, D)
n = 4 (1.24%)
Glutamic acid (Glu, E)
n = 11 (3.42%)
Asparagine (Asn, N)
n = 15 (4.66%)
Glutamine (Gln, Q)
n = 6 (1.86%)
Histidine (His, H)
n = 1 (0.31%)
Lysine (Lys, K)
n = 7 (2.17%)
Arginine (Arg, R)
n = 7 (2.17%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 17 19 3 6 32 2 14 6 0 0 2 8 0 5 17
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 0 1 3 10 6 1 4 6 6 0 3 5 16 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 10 0 5 8 12 0 0 1 2 11 1 1 2 13 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 10 1 0 4 7 0 0 0 7 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
61 81 96 85
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
34 93 57 139
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
12 116 161 34
ND2 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 27 (7.83%)
Serine (Ser, S)
n = 30 (8.7%)
Threonine (Thr, T)
n = 43 (12.46%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (0.58%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 38 (11.01%)
Methionine (Met, M)
n = 25 (7.25%)
Proline (Pro, P)
n = 16 (4.64%)
Phenylalanine (Phe, F)
n = 9 (2.61%)
Tyrosine (Tyr, Y)
n = 9 (2.61%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 18 (5.22%)
Glutamine (Gln, Q)
n = 13 (3.77%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 21 24 6 10 32 2 13 13 0 0 0 2 0 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 11 14 1 3 1 9 0 0 3 13 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 22 0 2 7 15 0 2 4 1 8 0 0 3 15 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 1 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 90 143 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 110 66 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 109 189 44
ND3 (size: 1039 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 13 (3.77%)
Alanine (Ala, A)
n = 27 (7.83%)
Serine (Ser, S)
n = 30 (8.7%)
Threonine (Thr, T)
n = 43 (12.46%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 2 (0.58%)
Leucine (Leu, L)
n = 63 (18.26%)
Isoleucine (Ile, I)
n = 38 (11.01%)
Methionine (Met, M)
n = 25 (7.25%)
Proline (Pro, P)
n = 16 (4.64%)
Phenylalanine (Phe, F)
n = 9 (2.61%)
Tyrosine (Tyr, Y)
n = 9 (2.61%)
Tryptophan (Trp, W)
n = 10 (2.9%)
Aspartic acid (Asp, D)
n = 1 (0.29%)
Glutamic acid (Glu, E)
n = 5 (1.45%)
Asparagine (Asn, N)
n = 18 (5.22%)
Glutamine (Gln, Q)
n = 13 (3.77%)
Histidine (His, H)
n = 7 (2.03%)
Lysine (Lys, K)
n = 13 (3.77%)
Arginine (Arg, R)
n = 4 (1.16%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
17 21 24 6 10 32 2 13 13 0 0 0 2 0 4 5
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 11 14 1 3 1 9 0 0 3 13 0 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
17 22 0 2 7 15 0 2 4 1 8 0 0 3 15 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
6 5 0 0 1 13 0 0 0 4 0 0 0 0 0 10
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
48 90 143 65
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
33 110 66 137
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 109 189 44
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 18 (3.92%)
Alanine (Ala, A)
n = 24 (5.23%)
Serine (Ser, S)
n = 36 (7.84%)
Threonine (Thr, T)
n = 59 (12.85%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 7 (1.53%)
Leucine (Leu, L)
n = 90 (19.61%)
Isoleucine (Ile, I)
n = 43 (9.37%)
Methionine (Met, M)
n = 34 (7.41%)
Proline (Pro, P)
n = 24 (5.23%)
Phenylalanine (Phe, F)
n = 16 (3.49%)
Tyrosine (Tyr, Y)
n = 9 (1.96%)
Tryptophan (Trp, W)
n = 13 (2.83%)
Aspartic acid (Asp, D)
n = 3 (0.65%)
Glutamic acid (Glu, E)
n = 10 (2.18%)
Asparagine (Asn, N)
n = 20 (4.36%)
Glutamine (Gln, Q)
n = 14 (3.05%)
Histidine (His, H)
n = 15 (3.27%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 10 (2.18%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 29 31 10 3 56 3 18 14 0 0 2 5 0 5 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 3 2 4 12 8 0 3 5 7 3 1 5 18 0 5
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 29 1 3 3 23 0 0 7 5 4 1 0 1 19 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
13 10 0 0 3 10 0 1 2 7 0 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
62 135 173 90
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 136 81 190
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
11 144 248 57
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 2 (2.04%)
Alanine (Ala, A)
n = 5 (5.1%)
Serine (Ser, S)
n = 14 (14.29%)
Threonine (Thr, T)
n = 6 (6.12%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 3 (3.06%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 4 (4.08%)
Methionine (Met, M)
n = 9 (9.18%)
Proline (Pro, P)
n = 4 (4.08%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 1 (1.02%)
Tryptophan (Trp, W)
n = 0 (0%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 2 (2.04%)
Asparagine (Asn, N)
n = 5 (5.1%)
Glutamine (Gln, Q)
n = 4 (4.08%)
Histidine (His, H)
n = 4 (4.08%)
Lysine (Lys, K)
n = 1 (1.02%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
0 4 8 2 2 14 0 3 4 0 0 2 1 0 1 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 1 2 1 1 3 0 0 1 1 0 0 1 3 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
3 2 0 0 4 6 1 0 3 0 1 0 1 0 5 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 0 0 0 1 0 0 0 2 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
12 32 28 27
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
10 26 18 45
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
3 38 51 7
ND5 (size: 1779 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (4.22%)
Alanine (Ala, A)
n = 40 (6.76%)
Serine (Ser, S)
n = 55 (9.29%)
Threonine (Thr, T)
n = 67 (11.32%)
Cysteine (Cys, C)
n = 6 (1.01%)
Valine (Val, V)
n = 13 (2.2%)
Leucine (Leu, L)
n = 84 (14.19%)
Isoleucine (Ile, I)
n = 58 (9.8%)
Methionine (Met, M)
n = 43 (7.26%)
Proline (Pro, P)
n = 29 (4.9%)
Phenylalanine (Phe, F)
n = 33 (5.57%)
Tyrosine (Tyr, Y)
n = 13 (2.2%)
Tryptophan (Trp, W)
n = 13 (2.2%)
Aspartic acid (Asp, D)
n = 7 (1.18%)
Glutamic acid (Glu, E)
n = 11 (1.86%)
Asparagine (Asn, N)
n = 30 (5.07%)
Glutamine (Gln, Q)
n = 20 (3.38%)
Histidine (His, H)
n = 14 (2.36%)
Lysine (Lys, K)
n = 23 (3.89%)
Arginine (Arg, R)
n = 8 (1.35%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 43 39 10 14 43 2 13 19 1 4 3 6 0 8 25
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
4 0 6 3 21 16 0 0 9 13 3 2 5 22 0 9
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
26 30 2 1 16 28 0 1 9 6 7 2 2 6 24 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 10 1 2 5 22 1 0 4 4 0 0 0 1 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
96 140 231 126
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
62 181 119 231
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
18 227 277 71
ND6 (size: 528 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 25 (14.29%)
Alanine (Ala, A)
n = 8 (4.57%)
Serine (Ser, S)
n = 9 (5.14%)
Threonine (Thr, T)
n = 2 (1.14%)
Cysteine (Cys, C)
n = 5 (2.86%)
Valine (Val, V)
n = 31 (17.71%)
Leucine (Leu, L)
n = 23 (13.14%)
Isoleucine (Ile, I)
n = 10 (5.71%)
Methionine (Met, M)
n = 9 (5.14%)
Proline (Pro, P)
n = 4 (2.29%)
Phenylalanine (Phe, F)
n = 17 (9.71%)
Tyrosine (Tyr, Y)
n = 13 (7.43%)
Tryptophan (Trp, W)
n = 5 (2.86%)
Aspartic acid (Asp, D)
n = 7 (4.0%)
Glutamic acid (Glu, E)
n = 2 (1.14%)
Asparagine (Asn, N)
n = 2 (1.14%)
Glutamine (Gln, Q)
n = 0 (0%)
Histidine (His, H)
n = 0 (0%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 3 (1.71%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 0 3 0 0 0 0 5 0 0 15 2 2 12 17 0
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
6 5 0 5 0 1 2 12 1 2 10 2 0 2 0 0
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 2 6 0 0 1 2 0 13 0 3 18 2 0 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 0 2 6 1 0 0 1 1 1 0 1 0 0 0 2
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
73 7 26 70
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 21 24 90
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
56 5 19 96
Total protein-coding genes (size: 11340 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 209 (5.53%)
Alanine (Ala, A)
n = 241 (6.38%)
Serine (Ser, S)
n = 282 (7.47%)
Threonine (Thr, T)
n = 360 (9.53%)
Cysteine (Cys, C)
n = 29 (0.77%)
Valine (Val, V)
n = 154 (4.08%)
Leucine (Leu, L)
n = 602 (15.94%)
Isoleucine (Ile, I)
n = 328 (8.68%)
Methionine (Met, M)
n = 246 (6.51%)
Proline (Pro, P)
n = 207 (5.48%)
Phenylalanine (Phe, F)
n = 213 (5.64%)
Tyrosine (Tyr, Y)
n = 119 (3.15%)
Tryptophan (Trp, W)
n = 108 (2.86%)
Aspartic acid (Asp, D)
n = 59 (1.56%)
Glutamic acid (Glu, E)
n = 86 (2.28%)
Asparagine (Asn, N)
n = 163 (4.32%)
Glutamine (Gln, Q)
n = 105 (2.78%)
Histidine (His, H)
n = 103 (2.73%)
Lysine (Lys, K)
n = 87 (2.3%)
Arginine (Arg, R)
n = 69 (1.83%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
115 213 206 47 67 312 26 124 103 2 30 26 79 19 72 141
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
40 14 15 40 103 94 4 39 53 84 33 19 40 145 3 44
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
135 176 5 29 58 143 5 7 40 49 70 10 26 36 127 32
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
71 81 5 21 38 84 3 6 11 50 2 2 0 6 0 98
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
749 936 1233 860
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
464 1043 728 1543
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
183 1208 1787 600

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.