Viewing data for Sprattus sprattus


Scientific name Sprattus sprattus
Common name European sprat
Maximum lifespan 6.00 years (Sprattus sprattus@AnAge)

Total mtDNA (size: 16668 bases) GC AT G C A T
Base content (bases) 7889 8778 4669 3220 4352 4426
Base content per 1 kb (bases) 473 527 280 193 261 266
Base content (%) 47.3% 52.7%
Total protein-coding genes (size: 11403 bases) GC AT G C A T
Base content (bases) 5446 5957 3329 2117 3140 2817
Base content per 1 kb (bases) 478 522 292 186 275 247
Base content (%) 47.8% 52.2%
D-loop (size: 1014 bases) GC AT G C A T
Base content (bases) 387 627 219 168 325 302
Base content per 1 kb (bases) 382 618 216 166 321 298
Base content (%) 38.2% 61.8%
Total tRNA-coding genes (size: 1552 bases) GC AT G C A T
Base content (bases) 753 799 409 344 358 441
Base content per 1 kb (bases) 485 515 264 222 231 284
Base content (%) 48.5% 51.5%
Total rRNA-coding genes (size: 2639 bases) GC AT G C A T
Base content (bases) 1272 1366 692 580 517 849
Base content per 1 kb (bases) 482 518 262 220 196 322
Base content (%) 48.2% 51.8%
12S rRNA gene (size: 954 bases) GC AT G C A T
Base content (bases) 479 474 261 218 188 286
Base content per 1 kb (bases) 502 497 274 229 197 300
Base content (%) 50.2% 49.7%
16S rRNA gene (size: 1685 bases) GC AT G C A T
Base content (bases) 793 892 431 362 329 563
Base content per 1 kb (bases) 471 529 256 215 195 334
Base content (%) 47.1% 52.9%

ATP6 (size: 683 bases) GC AT G C A T
Base content (bases) 309 374 203 106 211 163
Base content per 1 kb (bases) 452 548 297 155 309 239
Base content (%) 45.2% 54.8%
ATP8 (size: 168 bases) GC AT G C A T
Base content (bases) 68 100 46 22 47 53
Base content per 1 kb (bases) 405 595 274 131 280 315
Base content (%) 40.5% 59.5%
COX1 (size: 1551 bases) GC AT G C A T
Base content (bases) 703 848 401 302 461 387
Base content per 1 kb (bases) 453 547 259 195 297 250
Base content (%) 45.3% 54.7%
COX2 (size: 691 bases) GC AT G C A T
Base content (bases) 312 379 187 125 190 189
Base content per 1 kb (bases) 452 548 271 181 275 274
Base content (%) 45.2% 54.8%
COX3 (size: 785 bases) GC AT G C A T
Base content (bases) 384 401 236 148 204 197
Base content per 1 kb (bases) 489 511 301 189 260 251
Base content (%) 48.9% 51.1%
CYTB (size: 1141 bases) GC AT G C A T
Base content (bases) 555 586 328 227 324 262
Base content per 1 kb (bases) 486 514 287 199 284 230
Base content (%) 48.6% 51.4%
ND1 (size: 975 bases) GC AT G C A T
Base content (bases) 480 495 292 188 287 208
Base content per 1 kb (bases) 492 508 299 193 294 213
Base content (%) 49.2% 50.8%
ND2 (size: 1045 bases) GC AT G C A T
Base content (bases) 528 517 340 188 284 233
Base content per 1 kb (bases) 505 495 325 180 272 223
Base content (%) 50.5% 49.5%
ND3 (size: 349 bases) GC AT G C A T
Base content (bases) 166 183 100 66 105 78
Base content per 1 kb (bases) 476 524 287 189 301 223
Base content (%) 47.6% 52.4%
ND4 (size: 1381 bases) GC AT G C A T
Base content (bases) 684 697 404 280 371 326
Base content per 1 kb (bases) 495 505 293 203 269 236
Base content (%) 49.5% 50.5%
ND4L (size: 297 bases) GC AT G C A T
Base content (bases) 153 144 101 52 75 69
Base content per 1 kb (bases) 515 485 340 175 253 232
Base content (%) 51.5% 48.5%
ND5 (size: 1836 bases) GC AT G C A T
Base content (bases) 857 979 536 321 505 474
Base content per 1 kb (bases) 467 533 292 175 275 258
Base content (%) 46.7% 53.3%
ND6 (size: 522 bases) GC AT G C A T
Base content (bases) 253 269 158 95 82 187
Base content per 1 kb (bases) 485 515 303 182 157 358
Base content (%) 48.5% 51.5%

ATP6 (size: 683 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 11 (4.87%)
Alanine (Ala, A)
n = 19 (8.41%)
Serine (Ser, S)
n = 8 (3.54%)
Threonine (Thr, T)
n = 22 (9.73%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 16 (7.08%)
Leucine (Leu, L)
n = 51 (22.57%)
Isoleucine (Ile, I)
n = 17 (7.52%)
Methionine (Met, M)
n = 11 (4.87%)
Proline (Pro, P)
n = 18 (7.96%)
Phenylalanine (Phe, F)
n = 12 (5.31%)
Tyrosine (Tyr, Y)
n = 5 (2.21%)
Tryptophan (Trp, W)
n = 5 (2.21%)
Aspartic acid (Asp, D)
n = 1 (0.44%)
Glutamic acid (Glu, E)
n = 4 (1.77%)
Asparagine (Asn, N)
n = 8 (3.54%)
Glutamine (Gln, Q)
n = 9 (3.98%)
Histidine (His, H)
n = 3 (1.33%)
Lysine (Lys, K)
n = 1 (0.44%)
Arginine (Arg, R)
n = 6 (2.65%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
10 7 3 19 10 10 5 7 4 5 6 5 3 2 9 3
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 0 2 7 7 3 2 3 4 2 4 7 6 1 8
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
6 7 1 0 0 3 0 0 5 4 1 0 0 6 2 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
2 4 0 0 1 1 0 0 2 3 1 0 0 0 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
51 80 64 32
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
27 62 31 107
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
28 61 67 71
ATP8 (size: 168 bases)
Amino acid sequence: MPQLNPAPWFAILVFSWVVFLTIIPQKILAHNFNNEPTTMGAEKAKPEPWNWPWY*
Amino acid frequencies:
Glycine (Gly, G)
n = 1 (1.82%)
Alanine (Ala, A)
n = 5 (9.09%)
Serine (Ser, S)
n = 1 (1.82%)
Threonine (Thr, T)
n = 3 (5.45%)
Cysteine (Cys, C)
n = 0 (0%)
Valine (Val, V)
n = 3 (5.45%)
Leucine (Leu, L)
n = 4 (7.27%)
Isoleucine (Ile, I)
n = 4 (7.27%)
Methionine (Met, M)
n = 2 (3.64%)
Proline (Pro, P)
n = 8 (14.55%)
Phenylalanine (Phe, F)
n = 4 (7.27%)
Tyrosine (Tyr, Y)
n = 1 (1.82%)
Tryptophan (Trp, W)
n = 5 (9.09%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (5.45%)
Asparagine (Asn, N)
n = 5 (9.09%)
Glutamine (Gln, Q)
n = 2 (3.64%)
Histidine (His, H)
n = 1 (1.82%)
Lysine (Lys, K)
n = 3 (5.45%)
Arginine (Arg, R)
n = 0 (0%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 2 1 1 0 0 0 2 2 0 1 1 1 0 2 2
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
1 0 0 1 3 1 0 0 0 0 1 3 4 1 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 1 0 0 1 0 0 0 0 0 1 0 1 2 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
0 2 1 0 0 3 0 0 0 0 0 0 0 1 0 5
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
12 12 17 15
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
6 17 16 17
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
4 17 20 15
COX1 (size: 1551 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 46 (8.91%)
Alanine (Ala, A)
n = 47 (9.11%)
Serine (Ser, S)
n = 30 (5.81%)
Threonine (Thr, T)
n = 36 (6.98%)
Cysteine (Cys, C)
n = 1 (0.19%)
Valine (Val, V)
n = 43 (8.33%)
Leucine (Leu, L)
n = 63 (12.21%)
Isoleucine (Ile, I)
n = 38 (7.36%)
Methionine (Met, M)
n = 24 (4.65%)
Proline (Pro, P)
n = 28 (5.43%)
Phenylalanine (Phe, F)
n = 42 (8.14%)
Tyrosine (Tyr, Y)
n = 18 (3.49%)
Tryptophan (Trp, W)
n = 17 (3.29%)
Aspartic acid (Asp, D)
n = 14 (2.71%)
Glutamic acid (Glu, E)
n = 11 (2.13%)
Asparagine (Asn, N)
n = 14 (2.71%)
Glutamine (Gln, Q)
n = 8 (1.55%)
Histidine (His, H)
n = 19 (3.68%)
Lysine (Lys, K)
n = 9 (1.74%)
Arginine (Arg, R)
n = 8 (1.55%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
30 8 4 18 11 23 4 6 6 2 11 7 19 6 12 30
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
20 0 1 7 19 19 2 7 3 20 16 7 11 6 4 12
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
8 16 0 5 7 12 1 2 3 7 11 1 1 8 6 5
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 8 3 7 7 6 3 2 0 5 1 0 0 1 0 16
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
161 119 126 111
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
77 136 94 210
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
64 146 167 140
COX2 (size: 691 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 9 (3.93%)
Alanine (Ala, A)
n = 15 (6.55%)
Serine (Ser, S)
n = 17 (7.42%)
Threonine (Thr, T)
n = 9 (3.93%)
Cysteine (Cys, C)
n = 2 (0.87%)
Valine (Val, V)
n = 23 (10.04%)
Leucine (Leu, L)
n = 30 (13.1%)
Isoleucine (Ile, I)
n = 18 (7.86%)
Methionine (Met, M)
n = 12 (5.24%)
Proline (Pro, P)
n = 14 (6.11%)
Phenylalanine (Phe, F)
n = 7 (3.06%)
Tyrosine (Tyr, Y)
n = 9 (3.93%)
Tryptophan (Trp, W)
n = 5 (2.18%)
Aspartic acid (Asp, D)
n = 13 (5.68%)
Glutamic acid (Glu, E)
n = 14 (6.11%)
Asparagine (Asn, N)
n = 5 (2.18%)
Glutamine (Gln, Q)
n = 9 (3.93%)
Histidine (His, H)
n = 10 (4.37%)
Lysine (Lys, K)
n = 3 (1.31%)
Arginine (Arg, R)
n = 6 (2.62%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 4 7 10 3 9 3 3 7 2 5 6 8 4 1 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
5 2 0 2 7 5 1 1 1 5 2 4 6 4 0 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
2 4 2 5 5 4 0 0 3 4 5 2 2 1 4 3
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 12 2 4 9 3 0 0 3 2 1 0 0 0 0 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
74 64 50 42
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
25 52 63 90
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
26 71 76 57
COX3 (size: 785 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 22 (8.46%)
Alanine (Ala, A)
n = 21 (8.08%)
Serine (Ser, S)
n = 15 (5.77%)
Threonine (Thr, T)
n = 25 (9.62%)
Cysteine (Cys, C)
n = 2 (0.77%)
Valine (Val, V)
n = 20 (7.69%)
Leucine (Leu, L)
n = 29 (11.15%)
Isoleucine (Ile, I)
n = 13 (5.0%)
Methionine (Met, M)
n = 6 (2.31%)
Proline (Pro, P)
n = 12 (4.62%)
Phenylalanine (Phe, F)
n = 25 (9.62%)
Tyrosine (Tyr, Y)
n = 12 (4.62%)
Tryptophan (Trp, W)
n = 12 (4.62%)
Aspartic acid (Asp, D)
n = 5 (1.92%)
Glutamic acid (Glu, E)
n = 9 (3.46%)
Asparagine (Asn, N)
n = 2 (0.77%)
Glutamine (Gln, Q)
n = 8 (3.08%)
Histidine (His, H)
n = 16 (6.15%)
Lysine (Lys, K)
n = 2 (0.77%)
Arginine (Arg, R)
n = 5 (1.92%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
7 6 4 4 3 16 1 5 4 4 6 3 8 3 7 18
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
2 1 1 1 9 10 1 4 2 8 8 3 7 2 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 6 3 2 3 6 1 0 3 2 10 1 0 0 2 2
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
14 7 2 0 5 1 1 1 1 3 0 0 0 0 0 11
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
77 65 51 68
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
44 70 54 93
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
27 101 91 42
CYTB (size: 1141 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 27 (7.12%)
Alanine (Ala, A)
n = 37 (9.76%)
Serine (Ser, S)
n = 24 (6.33%)
Threonine (Thr, T)
n = 21 (5.54%)
Cysteine (Cys, C)
n = 3 (0.79%)
Valine (Val, V)
n = 28 (7.39%)
Leucine (Leu, L)
n = 57 (15.04%)
Isoleucine (Ile, I)
n = 25 (6.6%)
Methionine (Met, M)
n = 11 (2.9%)
Proline (Pro, P)
n = 21 (5.54%)
Phenylalanine (Phe, F)
n = 31 (8.18%)
Tyrosine (Tyr, Y)
n = 14 (3.69%)
Tryptophan (Trp, W)
n = 13 (3.43%)
Aspartic acid (Asp, D)
n = 10 (2.64%)
Glutamic acid (Glu, E)
n = 5 (1.32%)
Asparagine (Asn, N)
n = 18 (4.75%)
Glutamine (Gln, Q)
n = 6 (1.58%)
Histidine (His, H)
n = 12 (3.17%)
Lysine (Lys, K)
n = 9 (2.37%)
Arginine (Arg, R)
n = 8 (2.11%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
15 10 3 11 11 15 11 7 3 3 4 10 10 4 9 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
8 0 3 7 10 15 5 3 3 10 11 5 9 4 3 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
7 8 0 5 5 9 3 0 2 5 9 4 2 5 13 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
11 2 3 3 7 3 6 0 0 4 4 0 0 0 0 9
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
107 95 86 92
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
53 101 74 152
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
67 132 102 79
ND1 (size: 975 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 17 (5.25%)
Alanine (Ala, A)
n = 37 (11.42%)
Serine (Ser, S)
n = 24 (7.41%)
Threonine (Thr, T)
n = 22 (6.79%)
Cysteine (Cys, C)
n = 1 (0.31%)
Valine (Val, V)
n = 17 (5.25%)
Leucine (Leu, L)
n = 61 (18.83%)
Isoleucine (Ile, I)
n = 20 (6.17%)
Methionine (Met, M)
n = 13 (4.01%)
Proline (Pro, P)
n = 23 (7.1%)
Phenylalanine (Phe, F)
n = 20 (6.17%)
Tyrosine (Tyr, Y)
n = 11 (3.4%)
Tryptophan (Trp, W)
n = 8 (2.47%)
Aspartic acid (Asp, D)
n = 4 (1.23%)
Glutamic acid (Glu, E)
n = 11 (3.4%)
Asparagine (Asn, N)
n = 9 (2.78%)
Glutamine (Gln, Q)
n = 6 (1.85%)
Histidine (His, H)
n = 5 (1.54%)
Lysine (Lys, K)
n = 7 (2.16%)
Arginine (Arg, R)
n = 8 (2.47%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
14 6 4 11 13 10 11 11 3 3 5 4 7 1 9 11
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
9 1 0 3 17 12 5 2 7 2 6 5 14 1 3 4
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
11 7 0 9 4 4 2 1 4 7 4 4 5 6 3 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
4 5 6 2 2 5 2 0 0 3 5 0 0 0 1 4
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
86 87 76 76
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
39 101 54 131
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
63 104 78 80
ND2 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 44 (12.68%)
Serine (Ser, S)
n = 24 (6.92%)
Threonine (Thr, T)
n = 44 (12.68%)
Cysteine (Cys, C)
n = 3 (0.86%)
Valine (Val, V)
n = 17 (4.9%)
Leucine (Leu, L)
n = 66 (19.02%)
Isoleucine (Ile, I)
n = 18 (5.19%)
Methionine (Met, M)
n = 18 (5.19%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 8 (2.31%)
Glutamine (Gln, Q)
n = 13 (3.75%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 6 11 20 11 10 14 5 6 7 3 9 3 2 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 2 8 16 14 6 3 3 5 5 8 8 3 1 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 5 6 7 8 1 2 0 6 3 6 3 6 4 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 2 2 1 1 5 3 2 1 2 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 100 102 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 126 51 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
64 114 80 90
ND3 (size: 1045 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 16 (4.61%)
Alanine (Ala, A)
n = 44 (12.68%)
Serine (Ser, S)
n = 24 (6.92%)
Threonine (Thr, T)
n = 44 (12.68%)
Cysteine (Cys, C)
n = 3 (0.86%)
Valine (Val, V)
n = 17 (4.9%)
Leucine (Leu, L)
n = 66 (19.02%)
Isoleucine (Ile, I)
n = 18 (5.19%)
Methionine (Met, M)
n = 18 (5.19%)
Proline (Pro, P)
n = 20 (5.76%)
Phenylalanine (Phe, F)
n = 11 (3.17%)
Tyrosine (Tyr, Y)
n = 9 (2.59%)
Tryptophan (Trp, W)
n = 11 (3.17%)
Aspartic acid (Asp, D)
n = 2 (0.58%)
Glutamic acid (Glu, E)
n = 4 (1.15%)
Asparagine (Asn, N)
n = 8 (2.31%)
Glutamine (Gln, Q)
n = 13 (3.75%)
Histidine (His, H)
n = 7 (2.02%)
Lysine (Lys, K)
n = 8 (2.31%)
Arginine (Arg, R)
n = 5 (1.44%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
12 6 11 20 11 10 14 5 6 7 3 9 3 2 5 6
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 1 2 8 16 14 6 3 3 5 5 8 8 3 1 13
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
20 5 6 7 8 1 2 0 6 3 6 3 6 4 4 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
7 2 2 1 1 5 3 2 1 2 0 0 0 0 0 8
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
83 100 102 63
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
41 126 51 130
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
64 114 80 90
ND4 (size: 1381 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 29 (6.32%)
Alanine (Ala, A)
n = 44 (9.59%)
Serine (Ser, S)
n = 26 (5.66%)
Threonine (Thr, T)
n = 38 (8.28%)
Cysteine (Cys, C)
n = 5 (1.09%)
Valine (Val, V)
n = 21 (4.58%)
Leucine (Leu, L)
n = 87 (18.95%)
Isoleucine (Ile, I)
n = 35 (7.63%)
Methionine (Met, M)
n = 26 (5.66%)
Proline (Pro, P)
n = 28 (6.1%)
Phenylalanine (Phe, F)
n = 17 (3.7%)
Tyrosine (Tyr, Y)
n = 13 (2.83%)
Tryptophan (Trp, W)
n = 20 (4.36%)
Aspartic acid (Asp, D)
n = 4 (0.87%)
Glutamic acid (Glu, E)
n = 12 (2.61%)
Asparagine (Asn, N)
n = 13 (2.83%)
Glutamine (Gln, Q)
n = 9 (1.96%)
Histidine (His, H)
n = 11 (2.4%)
Lysine (Lys, K)
n = 10 (2.18%)
Arginine (Arg, R)
n = 12 (2.61%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
18 17 12 23 15 18 16 10 3 6 4 6 9 2 10 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
14 2 3 7 20 11 6 1 7 7 14 7 11 5 5 6
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
14 16 2 3 7 6 2 1 7 8 5 8 5 4 9 1
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 6 6 1 3 4 6 0 3 5 4 0 0 0 0 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
110 132 130 88
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 128 72 186
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
96 144 124 96
ND4L (size: 297 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 5 (5.1%)
Alanine (Ala, A)
n = 12 (12.24%)
Serine (Ser, S)
n = 6 (6.12%)
Threonine (Thr, T)
n = 10 (10.2%)
Cysteine (Cys, C)
n = 3 (3.06%)
Valine (Val, V)
n = 5 (5.1%)
Leucine (Leu, L)
n = 22 (22.45%)
Isoleucine (Ile, I)
n = 2 (2.04%)
Methionine (Met, M)
n = 5 (5.1%)
Proline (Pro, P)
n = 3 (3.06%)
Phenylalanine (Phe, F)
n = 7 (7.14%)
Tyrosine (Tyr, Y)
n = 0 (0%)
Tryptophan (Trp, W)
n = 1 (1.02%)
Aspartic acid (Asp, D)
n = 0 (0%)
Glutamic acid (Glu, E)
n = 3 (3.06%)
Asparagine (Asn, N)
n = 4 (4.08%)
Glutamine (Gln, Q)
n = 5 (5.1%)
Histidine (His, H)
n = 3 (3.06%)
Lysine (Lys, K)
n = 0 (0%)
Arginine (Arg, R)
n = 2 (2.04%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
1 1 2 3 6 9 1 0 5 0 1 1 1 2 3 4
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
3 2 1 1 7 3 1 0 4 1 0 0 0 2 1 1
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
5 3 1 1 3 0 0 1 1 0 0 1 3 1 3 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
3 2 1 0 0 0 0 0 1 1 0 0 0 1 0 0
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
25 32 23 19
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
13 29 16 41
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
14 40 30 15
ND5 (size: 1836 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 31 (5.07%)
Alanine (Ala, A)
n = 60 (9.82%)
Serine (Ser, S)
n = 44 (7.2%)
Threonine (Thr, T)
n = 63 (10.31%)
Cysteine (Cys, C)
n = 6 (0.98%)
Valine (Val, V)
n = 34 (5.56%)
Leucine (Leu, L)
n = 86 (14.08%)
Isoleucine (Ile, I)
n = 48 (7.86%)
Methionine (Met, M)
n = 30 (4.91%)
Proline (Pro, P)
n = 28 (4.58%)
Phenylalanine (Phe, F)
n = 39 (6.38%)
Tyrosine (Tyr, Y)
n = 12 (1.96%)
Tryptophan (Trp, W)
n = 14 (2.29%)
Aspartic acid (Asp, D)
n = 13 (2.13%)
Glutamic acid (Glu, E)
n = 11 (1.8%)
Asparagine (Asn, N)
n = 29 (4.75%)
Glutamine (Gln, Q)
n = 19 (3.11%)
Histidine (His, H)
n = 14 (2.29%)
Lysine (Lys, K)
n = 20 (3.27%)
Arginine (Arg, R)
n = 10 (1.64%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
26 22 8 21 15 23 12 10 10 9 14 10 9 1 17 22
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
22 3 3 9 28 19 4 5 11 5 10 10 11 4 3 11
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
24 20 8 5 14 11 1 4 9 4 8 2 5 11 18 4
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
10 5 6 6 7 9 11 0 0 7 3 0 0 0 1 12
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
149 142 203 118
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
74 182 119 237
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
98 212 152 150
ND6 (size: 522 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 20 (11.56%)
Alanine (Ala, A)
n = 21 (12.14%)
Serine (Ser, S)
n = 8 (4.62%)
Threonine (Thr, T)
n = 5 (2.89%)
Cysteine (Cys, C)
n = 4 (2.31%)
Valine (Val, V)
n = 27 (15.61%)
Leucine (Leu, L)
n = 27 (15.61%)
Isoleucine (Ile, I)
n = 2 (1.16%)
Methionine (Met, M)
n = 9 (5.2%)
Proline (Pro, P)
n = 6 (3.47%)
Phenylalanine (Phe, F)
n = 17 (9.83%)
Tyrosine (Tyr, Y)
n = 8 (4.62%)
Tryptophan (Trp, W)
n = 3 (1.73%)
Aspartic acid (Asp, D)
n = 3 (1.73%)
Glutamic acid (Glu, E)
n = 4 (2.31%)
Asparagine (Asn, N)
n = 1 (0.58%)
Glutamine (Gln, Q)
n = 1 (0.58%)
Histidine (His, H)
n = 1 (0.58%)
Lysine (Lys, K)
n = 2 (1.16%)
Arginine (Arg, R)
n = 4 (2.31%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
2 0 2 2 0 7 6 7 1 0 10 3 8 6 10 7
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
7 3 1 7 6 6 2 6 2 1 11 3 3 0 0 2
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
0 0 3 1 2 1 0 2 2 6 2 0 5 0 1 0
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
1 0 4 1 2 1 1 1 0 1 2 0 0 0 1 3
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
75 27 23 49
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
35 36 21 82
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
48 32 38 56
Total protein-coding genes (size: 11424 bases)
Amino acid sequence:
Amino acid frequencies:
Glycine (Gly, G)
n = 240 (6.31%)
Alanine (Ala, A)
n = 372 (9.78%)
Serine (Ser, S)
n = 233 (6.13%)
Threonine (Thr, T)
n = 304 (7.99%)
Cysteine (Cys, C)
n = 31 (0.81%)
Valine (Val, V)
n = 263 (6.91%)
Leucine (Leu, L)
n = 609 (16.01%)
Isoleucine (Ile, I)
n = 246 (6.47%)
Methionine (Met, M)
n = 172 (4.52%)
Proline (Pro, P)
n = 217 (5.7%)
Phenylalanine (Phe, F)
n = 239 (6.28%)
Tyrosine (Tyr, Y)
n = 115 (3.02%)
Tryptophan (Trp, W)
n = 119 (3.13%)
Aspartic acid (Asp, D)
n = 73 (1.92%)
Glutamic acid (Glu, E)
n = 97 (2.55%)
Asparagine (Asn, N)
n = 117 (3.08%)
Glutamine (Gln, Q)
n = 98 (2.58%)
Histidine (His, H)
n = 102 (2.68%)
Lysine (Lys, K)
n = 75 (1.97%)
Arginine (Arg, R)
n = 77 (2.02%)
Codon statistics:
AUU AUC AUA CUU CUC CUA CUG UUA CAA CAG GUU GUC GUA GUG UUU UUC
155 91 62 149 102 159 85 77 56 42 72 66 88 37 98 141
AUG UGU UGC GCU GCC GCA GCG GGU GGC GGA GGG CCU CCC CCA CCG ACU
110 15 16 57 153 126 36 34 50 69 87 60 96 39 22 69
ACC ACA ACG UCU UCC UCA UCG AGU AGC UAU UAC UGG UUG AAU AAC CAU
114 95 26 44 62 58 12 11 46 51 64 26 37 48 69 19
CAC GAA GAG GAU GAC AAA AAG CGU CGC CGA CGG AGA AGG UAA UAG UGA
83 60 37 26 47 42 33 7 11 38 21 0 0 3 3 93
Codons with 1st base G Codons with 1st base C Codons with 1st base A Codons with 1st base U
1045 989 971 800
Codons with 2nd base G Codons with 2nd base C Codons with 2nd base A Codons with 2nd base U
524 1069 683 1529
Codons with 3rd base G Codons with 3rd base C Codons with 3rd base A Codons with 3rd base U
614 1211 1065 915

Contact: Vadim E. Fraifeld, MD, PhD

Head: Lab for the Biology of Aging, The Shraga Segal Department of Microbiology, Immunology and Genetics, Faculty of Health Sciences, Ben-Gurion University of the Negev
P.O. Box 653, Beer-Sheva 8410501, Israel

Email:
How to cite us:

If you would like to cite this database please use:
Toren D, Barzilay T, Tacutu R, Lehmann G, Muradian KK, Fraifeld VE. MitoAge: a database for comparative analysis of mitochondrial DNA, with a special focus on animal longevity. Nucleic Acids Res. 2016; 44(D1):D1262-5.